DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and mfap4.2

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_012826893.1 Gene:mfap4.2 / 100488329 XenbaseID:XB-GENE-22167947 Length:261 Species:Xenopus tropicalis


Alignment Length:249 Identity:86/249 - (34%)
Similarity:124/249 - (49%) Gaps:22/249 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LFYLASAEI-GENVKIQT---YKKYSSSCKE---LNPKKSGVQKIQV--GSDVIEVYCDVTIAGK 70
            |..||.|.: |:.:|.|:   ...:.:.|::   |..|:.||..|..  .|..:.||||:|....
 Frog     9 LLLLACASVWGQKLKRQSDIGTGPFPADCEDVYALGSKEDGVYIIYPAGSSSALPVYCDMTTDEA 73

  Fly    71 GWLVVQRRVSVEENFYRNWTSYQTGFGDLKGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYA 135
            .|.|:|:|.....:|.|.||.|:.|||.....:::||:|:.:::..:...|.|||.||.....:|
 Frog    74 KWTVIQKRFDGSLSFSRGWTDYKLGFGRADEEYWLGLHNIYQLTLQKKYMLRIELGDFENNTAHA 138

  Fly   136 HYSVFHVGNVYSN-----YPITQLGAYSGTAGDSLSYHLYQPFSTFDRDNDNATINCAARYMGAW 195
            .|:.|.:.....|     |.:...|...|.|||||::|....|||||.|.|....|||..|...:
 Frog   139 EYTDFSLSPNAINPEDDGYTLFVDGFIDGGAGDSLTFHNGMKFSTFDHDQDTYQQNCAFLYSSGF 203

  Fly   196 WYRECLSRIPCSNLNGAYL-GGNHTDPALFGSGIVWGEWKGFTYSYKTVNIMVR 248
            |::.|    ..:|:||.|| ...:|..   |:||.|..||||.||.||..|.:|
 Frog   204 WFKGC----HLANINGPYLQDATYTSS---GNGITWTRWKGFNYSLKTTEIKIR 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 79/226 (35%)
mfap4.2XP_012826893.1 FReD 32..252 CDD:238040 79/226 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D405297at33208
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.