DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and mfap4.4

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001103327.2 Gene:mfap4.4 / 100126131 ZFINID:ZDB-GENE-071004-9 Length:242 Species:Danio rerio


Alignment Length:241 Identity:81/241 - (33%)
Similarity:120/241 - (49%) Gaps:21/241 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LASAEIGENVKIQTYKKYSSSCKEL---NPKKSGVQKI-QVGSDVIEVYCDVTIAGK-----GWL 73
            |.||.:..:.:...:     .|.::   ....||...| ..|...:.|||.:...||     ||.
Zfish    10 LLSAALASDCRFMQF-----DCSDIYNSGETLSGAYTIYPAGDSPVWVYCQMVSEGKDEDNGGWT 69

  Fly    74 VVQRRVSVEENFYRNWTSYQTGFGDLKGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYS 138
            |:|||:....||||.|..|:.|||:::|.:::||.||.:::..:...|.::|.||.|.:.:|.||
Zfish    70 VIQRRMDGSVNFYRPWRDYKRGFGNVEGEYWLGLENLYQLTRHKKFMLRVDLEDFEGRRGFAQYS 134

  Fly   139 VFHVGNVYSNYPITQLGAYSGTAGDSLSYHLYQPFSTFDRDNDNATINCAARYMGAWWYRECLSR 203
            .|.||.....|.:...|...|.||||::.|....|||||:|.|....|||..|:||:||..|.: 
Zfish   135 SFSVGCECEGYKLQVSGFTDGGAGDSMTPHNEMKFSTFDKDQDTYEKNCAKEYLGAFWYGYCHN- 198

  Fly   204 IPCSNLNGAYLGGNHTDPALFGSGIVWGEWKG-FTYSYKTVNIMVR 248
               :|.||.||.  ..|...|..|:.|..||. ...|.|.:::.::
Zfish   199 ---TNPNGVYLW--EDDSTHFAIGVTWYSWKNTHDMSLKYISMKIK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 78/225 (35%)
mfap4.4NP_001103327.2 FReD 25..239 CDD:238040 78/219 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D405297at33208
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.