DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and angptl7

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001096248.1 Gene:angptl7 / 100124808 XenbaseID:XB-GENE-6046184 Length:343 Species:Xenopus tropicalis


Alignment Length:220 Identity:87/220 - (39%)
Similarity:123/220 - (55%) Gaps:15/220 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SSCKELNPKKSGVQKIQ----VGSDVIEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQTGFG 97
            ||..:.|.|.|||.|:.    :||..:||:||:...|.||.::|||.....:|.|.|..|:.|||
 Frog   129 SSLFQKNYKISGVYKLPADDFLGSPELEVFCDMETQGGGWTLIQRRKIGLTSFNREWKQYREGFG 193

  Fly    98 DLKGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQLGAYSGTAG 162
            :::|:|::|..::.:::. :|..|.:||.|:.|..|:|.||.|.:.|..::|.:. ||.|||.||
 Frog   194 NIRGDFWLGNEHIYRLTR-RPTVLRVELEDWEGGVRHAEYSQFSISNEQNSYRLI-LGNYSGNAG 256

  Fly   163 -DSLSYHLYQPFSTFDRDNDNATINCAARYMGAWWYRECLSRIPCSNLNGAYL-GGNHTDPALFG 225
             |||.||....|||.|:|||....:||....|.:||..|..    |||||.|. .|.|..   ..
 Frog   257 RDSLRYHNNTAFSTKDKDNDKCLDDCAGLRKGGYWYNCCTD----SNLNGIYYRNGEHNK---HS 314

  Fly   226 SGIVWGEWKGFTYSYKTVNIMVRPK 250
            .||.|..|.|.:||.|.|.:.:||:
 Frog   315 DGISWYGWHGTSYSLKRVEMKIRPQ 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 86/218 (39%)
angptl7NP_001096248.1 FReD 126..338 CDD:238040 85/217 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I3986
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm48348
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.