DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and LOC100007488

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001315007.1 Gene:LOC100007488 / 100007488 -ID:- Length:245 Species:Danio rerio


Alignment Length:208 Identity:78/208 - (37%)
Similarity:111/208 - (53%) Gaps:12/208 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SGVQKIQVGSDV-IEVYCDVTIAGK-----GWLVVQRRVSVEENFYRNWTSYQTGFGDLKGNFFI 105
            ||:..|....|. :.|||.:...||     ||.|:|||:....||||.|..|:.|||.::|.:::
Zfish    41 SGIYSIYPAGDFPVWVYCQMVSEGKDEDKGGWTVIQRRMDGSVNFYRPWRDYKRGFGKVEGEYWL 105

  Fly   106 GLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQLGAYSGTAGDSLSYHLY 170
            ||.||.:::..:...|.::|.||.|.:.:|.||.|.||.....|.:...|...|.|||.||.|..
Zfish   106 GLENLYQLTRHKKFMLRVDLEDFEGRRGFAQYSSFSVGCECEGYKLQVSGFTDGGAGDCLSGHND 170

  Fly   171 QPFSTFDRDNDNATINCAARYMGAWWYRECLSRIPCSNLNGAYLGGNHTDPALFGSGIVWGEWKG 235
            ..|||||:|.|....:||..|:|.:||..|.:    :|.||.||.|.  ||..:..|:.|..||.
Zfish   171 LKFSTFDKDQDTHEKSCAKEYLGGFWYGSCHN----TNPNGVYLWGE--DPTHYAIGVCWSTWKN 229

  Fly   236 FTYSYKTVNIMVR 248
            :..|.||.::.::
Zfish   230 YAVSMKTFSMKIK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 78/208 (38%)
LOC100007488NP_001315007.1 FReD 25..244 CDD:238040 78/208 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D405297at33208
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.