DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and mfap4.3

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_001339903.1 Gene:mfap4.3 / 100007474 ZFINID:ZDB-GENE-110408-14 Length:242 Species:Danio rerio


Alignment Length:209 Identity:78/209 - (37%)
Similarity:110/209 - (52%) Gaps:13/209 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SGVQKI-QVGSDVIEVYCDVTIAGK-----GWLVVQRRVSVEENFYRNWTSYQTGFGDLKGNFFI 105
            |||..| ..|...:.|||.:...||     ||.|:|||:....||||.|..|:.|||:::|.:::
Zfish    37 SGVYTIYPAGETPVWVYCQMLSDGKDEENGGWTVIQRRMDGSVNFYRPWRDYKRGFGNVEGEYWL 101

  Fly   106 GLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQLGAYSGTAGDSLSYHLY 170
            ||.||.:::..:...|.::|.||.|.:.:|.||.|.||.....|.:...|...|.||||||.|..
Zfish   102 GLENLYQLTRHKKFMLRVDLEDFEGRRGFAQYSSFSVGCECEGYKLQVSGFTDGGAGDSLSPHNG 166

  Fly   171 QPFSTFDRDNDNATINCAARYMGAWWYRECLSRIPCSNLNGAYLGGNHTDPALFGSGIVWGEWKG 235
            ..|||||:|.|....|||..::|.:||..|.:    :|.|..||.  ..|......|:.|..|||
Zfish   167 MKFSTFDKDQDTYEKNCAKEFLGGFWYSSCHN----TNPNAVYLW--EEDVTHHAIGVSWYSWKG 225

  Fly   236 -FTYSYKTVNIMVR 248
             ...|.||:::.::
Zfish   226 THAVSMKTISMKIK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 78/209 (37%)
mfap4.3XP_001339903.1 FReD 23..239 CDD:238040 78/207 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.