DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and mfap4.12

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_001339837.3 Gene:mfap4.12 / 100007462 ZFINID:ZDB-GENE-110408-35 Length:247 Species:Danio rerio


Alignment Length:220 Identity:86/220 - (39%)
Similarity:118/220 - (53%) Gaps:16/220 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 CKELN---PKKSGVQKIQVGSDV-IEVYCDVTIAGK-----GWLVVQRRVSVEENFYRNWTSYQT 94
            |.|||   ...|||..|....|. :.|||.:...||     ||.|:|||:....||||.|..|:.
Zfish    31 CSELNKAGETLSGVYTIHPAGDAPVWVYCQMVSDGKDEENGGWTVIQRRMDGSVNFYRPWRDYKR 95

  Fly    95 GFGDLKGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQLGAYSG 159
            |||:|:|.:::||.||.:::..:...|.::|.||.|.|.:|.||.|.||.....|.:...|...|
Zfish    96 GFGNLEGEYWLGLENLYQLTRHKDHMLRVDLEDFEGRKGFAQYSSFSVGCETDGYQLQVSGFTDG 160

  Fly   160 TAGDSLSYHLYQPFSTFDRDNDNATINCAARYMGAWWYRECLSRIPCSNLNGAYLGGNHTDPALF 224
            .||||::||....|||||:|.||...:||..|:||:||..|..    :|.||.||.|.  |..:|
Zfish   161 GAGDSMTYHNGMKFSTFDKDQDNFDKSCARLYLGAFWYDNCHH----ANPNGVYLWGE--DATIF 219

  Fly   225 GSGIVWGEWK-GFTYSYKTVNIMVR 248
            ..|.||..|| .:....|::.:.::
Zfish   220 AIGNVWYGWKNNYGIGMKSITMKIK 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 86/220 (39%)
mfap4.12XP_001339837.3 FReD 26..244 CDD:238040 86/218 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D405297at33208
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.