DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and fgl1

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_001923586.2 Gene:fgl1 / 100003029 ZFINID:ZDB-GENE-130815-1 Length:307 Species:Danio rerio


Alignment Length:247 Identity:92/247 - (37%)
Similarity:125/247 - (50%) Gaps:36/247 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YLASAEIGENVKIQTYKKYSSSCKELNPKKSGVQKIQVGSDVIEVYCDVTIAGKGWLVVQRRVSV 81
            |:..|:|.:|      ...||....:.|.:|..:        :.|:||:| .|.||.:.|||...
Zfish    75 YMDCAQIFKN------GSTSSGFYMIKPLRSPTR--------VRVFCDMT-EGGGWTLFQRRSDG 124

  Fly    82 EENFYRNWTSYQTGFGDLK---GNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVG 143
            ..:|.|:|..|:.||||:|   |.|::|.:||:.::|.....|.|.|.||.|..|:|.|..|.|.
Zfish   125 SLSFDRDWNDYKIGFGDMKSANGEFWLGNDNLHYLTSQGDYTLRINLEDFEGTHRFAVYRNFKVD 189

  Fly   144 NVYSNYPITQLGAYSGTAGDSLS-----------YHLYQPFSTFDRDNDNATINCAARYMGAWWY 197
            |...:|.: |.|.|||||||:||           .|....|||.|||:|....|||....|.||:
Zfish   190 NEEKHYQL-QFGMYSGTAGDALSGSFHPEVQWWASHQGMKFSTRDRDHDRYDRNCAQEDKGGWWF 253

  Fly   198 RECLSRIPCSNLNGAYLGGNHTDPALFGSGIVWGEWKGFTYSYKTVNIMVRP 249
            ..|.|    :||||.|..|.::  |....||||..|.|:.||.|:|.:.:||
Zfish   254 NRCHS----ANLNGFYHRGAYS--ASTDDGIVWYPWHGWWYSLKSVQMKIRP 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 88/230 (38%)
fgl1XP_001923586.2 FReD 74..299 CDD:238040 90/245 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.