DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5550 and fgl2b

DIOPT Version :9

Sequence 1:NP_001246376.1 Gene:CG5550 / 36883 FlyBaseID:FBgn0034160 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_001341185.5 Gene:fgl2b / 100001116 ZFINID:ZDB-GENE-120709-53 Length:1447 Species:Danio rerio


Alignment Length:236 Identity:74/236 - (31%)
Similarity:122/236 - (51%) Gaps:27/236 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KKYSSSCKE--LNPKKSGVQKI--QVGSDVIEVYCDVTIAGKGWLVVQRRVSVEENFYRNWTSYQ 93
            |:.:..|.:  ...:::||.::  :..:....|:||:..:|.||.::|.|.....:|.|.|..|:
Zfish  1215 KRPAQDCADYITKSRRNGVYRVTPRPKNTTFPVFCDMASSGGGWTLIQHRFDGSTSFNRTWDEYK 1279

  Fly    94 TGFGDLKGNFFIGLNNLNKISSLQPQELYIELVDFAGEKRYAHYSVFHVGNVYSNYPITQLGAYS 158
            .|||.|.|.|::|.:.::.::..:...|.||:.||.|.:.||.|..|::.|....|.:: :..||
Zfish  1280 NGFGKLIGEFWLGNDKIHLLTKAKNMSLRIEIEDFEGIREYAQYDHFYIANESQQYRLS-IDGYS 1343

  Fly   159 GTAGDSLSY-----HLYQPFSTFDRDNDN-ATINCAARYMGAWWYRECLSRIPCSNLNGAYLGGN 217
            ||||:::.:     |..:.|:|.|||||. .:.||.|.|...||:..|:|    :||||.|....
Zfish  1344 GTAGNAMQFSKKYNHDQKFFTTPDRDNDQYPSGNCGAYYSSGWWFDACMS----ANLNGKYYQSK 1404

  Fly   218 HTDPALFGSGIVWGEWKGFT---------YSYKTVNIMVRP 249
            :..   ..:||.||.|...|         .|::||.:|:||
Zfish  1405 YKG---VRNGIFWGTWHNITMEYYPTNERQSFRTVRMMIRP 1442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5550NP_001246376.1 FReD 34..250 CDD:238040 73/235 (31%)
fgl2bXP_001341185.5 FReD 1219..1442 CDD:238040 71/230 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.