DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5522 and RAPGEF5

DIOPT Version :9

Sequence 1:NP_725613.1 Gene:CG5522 / 36881 FlyBaseID:FBgn0034158 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_036426.4 Gene:RAPGEF5 / 9771 HGNCID:16862 Length:883 Species:Homo sapiens


Alignment Length:240 Identity:59/240 - (24%)
Similarity:113/240 - (47%) Gaps:18/240 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 LANQITLLDFPVFAQIQPDELSSCAWTKKDKHVNTPNIVAFTKRFNHTSFWTVQEILNAEQPKQR 234
            ||.::...|:.:|..|...||....::::....:|.|:....:|.|....|...|||...|..:|
Human   652 LALELMNFDWSLFNSIHEQELIYFTFSRQGSGEHTANLSLLLQRCNEVQLWVATEILLCSQLGKR 716

  Fly   235 AEIITHFIKVAKKLHELNNLHSLFAIISAMQSASIYRLTKTWACLSKKDRNAFDRLSDIFSDQDN 299
            .:::..|||:|.......||:|.|||:..:.:||:.||::||..:..|.:..|..|..:.....|
Human   717 VQLVKKFIKIAAHCKAQRNLNSFFAIVMGLNTASVSRLSQTWEKIPGKFKKLFSELESLTDPSLN 781

  Fly   300 WANLRSYLESLRLPCIPYLGLFLTDLIYIDLAHPHKG------GLEPEQRRNKMNNILRVISNYQ 358
            ....|...:.::.|.||::.|.|.|:.:|     |:|      .|...::.:.:.:.:|.:.:.:
Human   782 HKAYRDAFKKMKPPKIPFMPLLLKDVTFI-----HEGNKTFLDNLVNFEKLHMIADTVRTLRHCR 841

  Fly   359 QSNYKHL--QKHEATQKYLTSIRYIEELQNIFEEDQYKRSLNLEP 401
            .:.:..|  ::|:..:.|:..:..|:..|.:||     .|..:||
Human   842 TNQFGDLSPKEHQELKSYVNHLYVIDSQQALFE-----LSHRIEP 881

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5522NP_725613.1 RasGEF 163..400 CDD:214539 57/237 (24%)
PH_RalGPS1_2 578..692 CDD:270120
PH 578..685 CDD:278594
RAPGEF5NP_036426.4 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.