DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5522 and CDC25

DIOPT Version :9

Sequence 1:NP_725613.1 Gene:CG5522 / 36881 FlyBaseID:FBgn0034158 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_013413.1 Gene:CDC25 / 851019 SGDID:S000004301 Length:1589 Species:Saccharomyces cerevisiae


Alignment Length:348 Identity:90/348 - (25%)
Similarity:164/348 - (47%) Gaps:52/348 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 EKTYKEQQMEPPSMQPQASKTLNIKSTRRKNSIGCLNSFSSSPDSPGCYYTIAASAAPPSKSQSL 146
            ||...|.:.||...:.|.|.:..:::|:|.|.            ||   ..:::|:.|.|.|.:.
Yeast  1244 EKLINENEKEPVDPKQQDSVSAVVQTTKRDNK------------SP---IHMSSSSLPSSASSAF 1293

  Fly   147 PAHASIKQLDAVILSALRVPADVLANQITLLDFPVFAQIQPDELSSCAW-TKKDKHVNTPNIVAF 210
            .....:|.||        :.....|.|:|:|:..::.:|...|....|| ||......:|||..|
Yeast  1294 FRLKKLKLLD--------IDPYTYATQLTVLEHDLYLRITMFECLDRAWGTKYCNMGGSPNITKF 1350

  Fly   211 TKRFNHTSFWTVQEILNAEQPKQRAEIITHFIKVAKKLHELNNLHSLFAIISAMQSASIYRLTKT 275
            ....|..:.:....|:.....|.|:::..:|:.||:...||||..|:.||:||:.|:.||||.||
Yeast  1351 IANANTLTNFVSHTIVKQADVKTRSKLTQYFVTVAQHCKELNNFSSMTAIVSALYSSPIYRLKKT 1415

  Fly   276 WACLSKKDRNAFDRLSDIFSDQDNWANLRSYLESLR-LPCIPYLGLFLTDLIYIDLAHP----HK 335
            |..:|.:.::....|:::...:.|:...|..|.|:. :.|:|:.|::|:||.:..:.:|    :.
Yeast  1416 WDLVSTESKDLLKNLNNLMDSKRNFVKYRELLRSVTDVACVPFFGVYLSDLTFTFVGNPDFLHNS 1480

  Fly   336 GGLEPEQRRNKMNNILRVISNYQQSNYKHLQKHEATQKYLTSIRYIEELQNIFE---------ED 391
            ..:....:|.|:.||:..|.::::.:||              ::.::::|.:.|         |.
Yeast  1481 TNIINFSKRTKIANIVEEIISFKRFHYK--------------LKRLDDIQTVIEASLENVPHIEK 1531

  Fly   392 QYKRSLNLEPASPSGPSSSSCSS 414
            ||:.||.:||.|.:...|:..||
Yeast  1532 QYQLSLQVEPRSGNTKGSTHASS 1554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5522NP_725613.1 RasGEF 163..400 CDD:214539 65/251 (26%)
PH_RalGPS1_2 578..692 CDD:270120
PH 578..685 CDD:278594
CDC25NP_013413.1 SH3_Sdc25 62..122 CDD:212816
RasGEFN 1117..1246 CDD:214571 1/1 (100%)
RasGEF 1301..1543 CDD:214539 69/263 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23113
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.