DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5522 and BUD5

DIOPT Version :9

Sequence 1:NP_725613.1 Gene:CG5522 / 36881 FlyBaseID:FBgn0034158 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_009967.2 Gene:BUD5 / 850405 SGDID:S000000634 Length:642 Species:Saccharomyces cerevisiae


Alignment Length:255 Identity:60/255 - (23%)
Similarity:113/255 - (44%) Gaps:38/255 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 ALRVPADVLANQITLLDFPVFAQIQPDELSSCAWTKKDKHVNTPNIVAFTKRFNHT-----SFWT 221
            ||.|....||..:|||:..::..|:                    .:.||:.|.|.     |.:|
Yeast   408 ALNVSPWSLAKTLTLLESSLYLDIE--------------------TIEFTRHFKHNDTTIDSVFT 452

  Fly   222 VQEILNA---EQPKQRAEIITHFIKVAKKLHELNNLHSLFAIISAMQSASIYRLTKTWACLSKKD 283
            :...|::   |...|:...|:::::||.....|.||:||.:||:::|:.||.||:..   :..|.
Yeast   453 LSNQLSSYVLETTLQQTHTISYWLQVALSCLYLRNLNSLASIITSLQNHSIERLSLP---IDVKS 514

  Fly   284 RNAFDRLSDIFSDQDNWANLRSYLESL---RLPCIPYLGLFLTDLIYI---DLAHPHKGGLEPEQ 342
            .:.|.||..:....:|:...|..::.:   :|||:|:..|.:.|:.:|   :......|.....|
Yeast   515 DHLFQRLKVVVHPNNNYNVYRRTIKHIFHSQLPCVPFTSLLIRDITFIRDGNDTFTKDGNNVNMQ 579

  Fly   343 RRNKMNNILRVISNYQQSNYKHLQKHEAT-QKYLTSIRYIEELQNIFEEDQYKRSLNLEP 401
            :.|::..|:......||..|:.:.....| :..|.::..:..|.|..::..|:.|:...|
Yeast   580 KFNQITKIVAFAQYLQQKQYEDIHCSNTTARSLLGAMIKVHTLYNDNKDRAYQVSIAKVP 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5522NP_725613.1 RasGEF 163..400 CDD:214539 58/251 (23%)
PH_RalGPS1_2 578..692 CDD:270120
PH 578..685 CDD:278594
BUD5NP_009967.2 RasGEFN 230..339 CDD:214571
RasGEF 409..640 CDD:214539 59/254 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23113
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.