DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5522 and Rasgef1c

DIOPT Version :9

Sequence 1:NP_725613.1 Gene:CG5522 / 36881 FlyBaseID:FBgn0034158 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_001334391.1 Gene:Rasgef1c / 74563 MGIID:1921813 Length:469 Species:Mus musculus


Alignment Length:482 Identity:108/482 - (22%)
Similarity:165/482 - (34%) Gaps:156/482 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SPPPPPSQQQQQPTRVSKQRSPNTNGSAHTM-------ACLRQEKTY------------------ 85
            ||||..|.:.:|..:.....:| ::.|..|:       |....||.|                  
Mouse    20 SPPPTESTEGEQAGQPLLDGAP-SSASLDTLIQHLVPTADYYPEKAYIFTFLLSSRLFIEPRELL 83

  Fly    86 --------KEQQMEPPSMQPQ-----ASKTLNI---------KSTRRKNSIG-----------C- 116
                    ::||::.|.:...     .:|.|.:         :....:::||           | 
Mouse    84 ARVCHLCIEQQQLDKPVLDKARVRKFGAKLLQLLAEWTETFPRDFEEESTIGHLTDVVGRISPCD 148

  Fly   117 -----------------LNSFSSSPDS-PGCYYTIAASAAPPSKSQSLPAHASIKQLDAVILSAL 163
                             |.|....|:| .|....|:....||         |||.:      ..|
Mouse   149 ETYGSRVHQLLQTLHQKLASLGQGPESLVGADKPISYRTKPP---------ASIHR------ELL 198

  Fly   164 RVPAD--VLANQITLLDFPVFAQIQPDELSSCAWTKKDKHVNTP--------NIVAFTKRFNHTS 218
            .|.:|  .||.|:|.::......|.|:|... |:..||....|.        |:.|:.|.||...
Mouse   199 GVCSDPYTLAQQLTHVELERLRHIGPEEFVQ-AFVNKDPLAGTKPRFSDKTNNVEAYVKWFNRLC 262

  Fly   219 FWTVQEILNAEQPKQRAEIITHFIKVAKKLHELNNLHSLFAIISAMQSASIYRLTKTWACLSKKD 283
            :....||....:.||||::|..||.||::...:.|.:||.||||.|..:.:.||.||||   |..
Mouse   263 YLVATEICMPAKKKQRAQVIEFFIDVARECFNIGNFNSLMAIISGMNMSPVSRLKKTWA---KVK 324

  Fly   284 RNAFDRLSDIFSDQDNWANLRSYL-----------ESLRLPCIPYLGLFLTDLIYIDLAHPHKGG 337
            ...|..|........|:.|.|:.|           .|.....||:..|.:.|:.:::        
Mouse   325 TAKFFILEHQMDPTGNFCNYRTALRGAAHRSLTAHSSREKIVIPFFSLLIKDIYFLN-------- 381

  Fly   338 LEPEQRRNKMNNILRVISNYQQSNY-KHLQKHEATQKYLT------------SIRYIEELQNIFE 389
               |...|::.|        ...|: |.|:..:...:::|            ||.:......||.
Mouse   382 ---EGCANRLPN--------GHVNFEKFLELAKQVGEFITWKQVECPFEQDPSITHYLYTAPIFS 435

  Fly   390 EDQYKRSLNLEPASPSGPSSSSCSSKE 416
            ||      .|..||....|..|.:.||
Mouse   436 ED------GLYLASYESESPESQTEKE 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5522NP_725613.1 RasGEF 163..400 CDD:214539 69/270 (26%)
PH_RalGPS1_2 578..692 CDD:270120
PH 578..685 CDD:278594
Rasgef1cNP_001334391.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.