DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5522 and SOS2

DIOPT Version :9

Sequence 1:NP_725613.1 Gene:CG5522 / 36881 FlyBaseID:FBgn0034158 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_008870.2 Gene:SOS2 / 6655 HGNCID:11188 Length:1332 Species:Homo sapiens


Alignment Length:509 Identity:116/509 - (22%)
Similarity:197/509 - (38%) Gaps:118/509 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 IKSTRRK------NSIGCLNSFSSSPDSPGCYYTIAASAAPPSKSQSLPAHASIKQLDAVILSAL 163
            |.|.|.|      .||..:........:.|..:.|...:.||.....:......:..|.:.|..:
Human   716 ISSVRGKAMKKWVESIAKIIRRKKQAQANGVSHNITFESPPPPIEWHISKPGQFETFDLMTLHPI 780

  Fly   164 RVPADVLANQITLLDFPVFAQIQPDELSSCAWTKKDKHVNTPNIVAFTKRFNHTSFWTVQEILNA 228
            .:     |.|:|||:..::.::||.||....|||:||.:|:||::...:...:.:.|..:.|:.|
Human   781 EI-----ARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVEA 840

  Fly   229 EQPKQRAEIITHFIKVAKKLHELNNLHSLFAIISAMQSASIYRLTKTWACLSKKDRNAFDRLSDI 293
            |..::|..:::..|::.:...:|||.:.:..|:||:.|.|:|||..|:..|.::.|...|...::
Human   841 ENFEERVAVLSRIIEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRKILDEAVEL 905

  Fly   294 FSDQDNWANLRSYLESLRLPCIPYLGLFLTDLIYIDLAH----PHKG-GLEPEQRRNKMNNILRV 353
              .||::......|:|:..||:|:.|::||:::..:..:    ..|| .|....:|.|:..|...
Human   906 --SQDHFKKYLVKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKKGKDLINFSKRRKVAEITGE 968

  Fly   354 ISNYQQSNYKHLQKHEATQKYLTSI-----RYIEEL-------QNIFEEDQYKRSLNLEPAS--- 403
            |..||            .|.|...|     |:.|.|       :..|.:..:.:||.:||.:   
Human   969 IQQYQ------------NQPYCLRIEPDMRRFFENLNPMGSASEKEFTDYLFNKSLEIEPRNCKQ 1021

  Fly   404 -PSGPSSSSCSSKESFNVEVVTPALGCLNLSPAKTIGSMRMASGTKFVPGHRKCRSLGTKFRSSS 467
             |..|..|:.|.|                 ||.....:.|..|.:..:.||           .:.
Human  1022 PPRFPRKSTFSLK-----------------SPGIRPNTGRHGSTSGTLRGH-----------PTP 1058

  Fly   468 LPRNFAEKCQCCIVMIA-------------------PGIGTIS----------NKRCRCRRIFGK 503
            |.|   |.|:.....||                   |.:...|          |..|....||..
Human  1059 LER---EPCKISFSRIAETELESTVSAPTSPNTPSTPPVSASSDLSVFLDVDLNSSCGSNSIFAP 1120

  Fly   504 I-ATHN----HSDGHPHHLHLE-LDPSQVQPRHHLLDDSVLEHSDALSQADLTS 551
            : ..|:    .|.|..|.|..| |.|..:.||      ...:|..:.|:.::.|
Human  1121 VLLPHSKSFFSSCGSLHKLSEEPLIPPPLPPR------KKFDHDASNSKGNMKS 1168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5522NP_725613.1 RasGEF 163..400 CDD:214539 66/253 (26%)
PH_RalGPS1_2 578..692 CDD:270120
PH 578..685 CDD:278594
SOS2NP_008870.2 Histone 63..169 CDD:329110
RhoGEF 199..386 CDD:238091
PH_SOS 437..543 CDD:269963
RasGEFN 595..739 CDD:214571 6/22 (27%)
RasGEF 774..1013 CDD:238087 66/257 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1018..1061 12/70 (17%)
NupH_GANP <1023..>1142 CDD:318883 28/149 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1076..1096 1/19 (5%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1142..1332 8/33 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.