DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5522 and rgl2

DIOPT Version :9

Sequence 1:NP_725613.1 Gene:CG5522 / 36881 FlyBaseID:FBgn0034158 Length:702 Species:Drosophila melanogaster
Sequence 2:XP_005158441.1 Gene:rgl2 / 65227 ZFINID:ZDB-GENE-010131-1 Length:744 Species:Danio rerio


Alignment Length:403 Identity:102/403 - (25%)
Similarity:172/403 - (42%) Gaps:95/403 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 IAASAAPPSKSQSLPAHASIKQLDAVILSALRVPADVLANQITLLDFPVFAQIQPDELSSCAWTK 197
            ::||.:.|:|....|.:.|  ..||.  |.|..|:.|:|.|:|.::..:|.::.|.......|::
Zfish   231 LSASLSDPTKGLLSPPNPS--DFDAT--SVLGFPSSVIAEQLTRIETDLFLKLVPHHCLGSLWSQ 291

  Fly   198 KDKHVNTP---NIVAFTKRFNH-------TSFWTVQEILNAEQPKQRAEIITHFIKVAKKLHELN 252
            :||.....   ::.|..|:||.       :..|     :...:.:|||.::..:|.||:......
Zfish   292 RDKKGQEGACWSVRATIKQFNRLANAVTASCLW-----MTTLKSQQRARLLEKWISVAEACRTRK 351

  Fly   253 NLHSLFAIISAMQSASIYRLTKTWACLSKKDRNA---FDRLSDIFSDQDNWA------------- 301
            |..||:||:||:||..|:||.|||   .:.||.|   ::.||||||::||::             
Zfish   352 NFSSLYAILSALQSNPIHRLRKTW---QETDREAVKRYEELSDIFSEKDNYSQSRELLKEEGTSK 413

  Fly   302 --------NLRSYLESLRLPCIPYLGLFLTDLIYIDLA---HPHKGGLEPEQRRNKMNNILRVIS 355
                    |.|.:..|.....:||||:||.||..:|.|   ....|.:..::||.:...|.::  
Zfish   414 FANHDTKINNRRFTGSCAQGTVPYLGIFLRDLTMLDTAVKDRLENGFINFDKRRREFEVIAQI-- 476

  Fly   356 NYQQSNYKH--LQKHEATQKYLTSIRYIEELQNIFEEDQYKRSLNLE-PASPSG----------- 406
            ...||:.|:  .:..|      |.|.:...:..:.||:.||.|..:| |..||.           
Zfish   477 RLLQSSCKNSIFRTDE------TFIHWYHSVPTLREEESYKLSNQIEAPGEPSPGRGLNPTVIIT 535

  Fly   407 --PSSSSCSSKESFNVE-------------------VVTPALGCLNLS---PAKTIGSMRMASGT 447
              |.:.|..:..:.:.:                   |.:|::.||::.   |:.......:.:.|
Zfish   536 QCPDALSAVANTTMDADGIFDFPSPVNQLLSKLCKHVKSPSVSCLDVDSSPPSNDSTPSILTTPT 600

  Fly   448 KFVPGHRKCRSLG 460
            ..|..||:..|.|
Zfish   601 TAVKSHRRSVSCG 613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5522NP_725613.1 RasGEF 163..400 CDD:214539 76/275 (28%)
PH_RalGPS1_2 578..692 CDD:270120
PH 578..685 CDD:278594
rgl2XP_005158441.1 REM 111..>190 CDD:100121
RasGEF 256..519 CDD:214539 77/278 (28%)
UBQ 626..710 CDD:294102
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.