DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5522 and Rapgef1

DIOPT Version :9

Sequence 1:NP_725613.1 Gene:CG5522 / 36881 FlyBaseID:FBgn0034158 Length:702 Species:Drosophila melanogaster
Sequence 2:XP_038962085.1 Gene:Rapgef1 / 63881 RGDID:619793 Length:1269 Species:Rattus norvegicus


Alignment Length:325 Identity:92/325 - (28%)
Similarity:146/325 - (44%) Gaps:76/325 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 SKTLNIKSTRRKNSIG---------CLNSFSSSPDSPGCYYTIAAS--AAPPSKSQSLPAHASIK 153
            |..|::....|||.:.         |.:|     |.|     :||.  ||.|.......:|.   
  Rat   984 SGELSLARVLRKNILDKVDQKKLLRCAHS-----DQP-----LAARGVAARPGTLHDFHSHE--- 1035

  Fly   154 QLDAVILSALRVPADVLANQITLLDFPVFAQIQPDELSSCAWTKKDKHVNTPNIVAFTKRFNHTS 218
                            :|.|:||||..:|.:|:..|:  ..|.|:.....:||:..||:.||:.|
  Rat  1036 ----------------IAEQLTLLDAELFYKIEIPEV--LLWAKEQNEEKSPNLTQFTEHFNNMS 1082

  Fly   219 FWTVQEILNAEQPKQRAEIITHFIKVAKKLHELNNLHSLFAIISAMQSASIYRLTKTWACLSKKD 283
            :|....|:..|:.:.|..::..|||:.|.|.:|||.:|..||:||:.||.|.||  .|      .
  Rat  1083 YWVRSVIMLQEKAQDRERLLLKFIKIMKHLRKLNNFNSYLAILSALDSAPIRRL--EW------Q 1139

  Fly   284 RNAFDRLSDIFSDQDNWANLRSY---LESLRLPCIPYLGLFLTDLIYIDLAHP-HKGGLEPEQRR 344
            |...:.|::..:..|:.::.|:|   |..:..||||||||.|.||.::.|.:| :..|.....:|
  Rat  1140 RQTSEGLAEYCTLIDSSSSFRAYRAALSEVEPPCIPYLGLILQDLTFVHLGNPDYIDGKVNFSKR 1204

  Fly   345 NKMNNILRVISNYQQSNYKHLQKHEATQKYLTSIRYIEELQNIF--------EEDQYKRSLNLEP 401
            .:..|||..:..:||.:|:              ||..:::.|.|        ||..::.||.::|
  Rat  1205 WQQFNILDSMRCFQQVHYE--------------IRRNDDIINFFNDFSDHLAEEALWELSLKIKP 1255

  Fly   402  401
              Rat  1256  1255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5522NP_725613.1 RasGEF 163..400 CDD:214539 76/248 (31%)
PH_RalGPS1_2 578..692 CDD:270120
PH 578..685 CDD:278594
Rapgef1XP_038962085.1 PHA03247 <230..351 CDD:223021
RasGEFN 880..1021 CDD:214571 11/46 (24%)
RasGEF 1028..1257 CDD:214539 78/271 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.