DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5522 and RASGRF1

DIOPT Version :9

Sequence 1:NP_725613.1 Gene:CG5522 / 36881 FlyBaseID:FBgn0034158 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_002882.3 Gene:RASGRF1 / 5923 HGNCID:9875 Length:1273 Species:Homo sapiens


Alignment Length:511 Identity:120/511 - (23%)
Similarity:199/511 - (38%) Gaps:146/511 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 YSELS--RKPTTDYNGYTGQAYAATQFKQSSP------PPPPSQQQQQPTRVSKQRSPNTNGSAH 74
            ||.:|  .|.|.|    |.:.|.::.|....|      |..|    :.|:.:|||.|.       
Human   786 YSAMSPFSKATLD----TSKLYVSSSFTNKIPDEGDTTPEKP----EDPSALSKQSSE------- 835

  Fly    75 TMACLRQEKTYKEQQMEPPSMQPQASKT-LNIKSTRRKNS--------------IGC--LNSFSS 122
              ..:|:|....:.|.:....:...:|: ...||.:.|||              ..|  |::..|
Human   836 --VSMREESDIDQNQSDDGDTETSPTKSPTTPKSVKNKNSSEFPLFSYNNGVVMTSCRELDNNRS 898

  Fly   123 SPDSPGCY-------------------YTIAASAAPPSK-------------------------- 142
            :..:...:                   .::|::..||.:                          
Human   899 ALSAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNGDKEFVIRRAATNRVLNVLRHWVS 963

  Fly   143 --SQSLPAHASIK-----------------------------------------QLDAVILSALR 164
              ||....:..:|                                         .|:.:...|..
Human   964 KHSQDFETNDELKCKVIGFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQITLEEITQMAEG 1028

  Fly   165 VPAD--------VLANQITLLDFPVFAQIQPDELSSCAWTKKDKHVNTPNIVAFTKRFNHTSFWT 221
            |.|:        .:|.|:||||..||.:|..:|.....|.|.:|:..||.|:..||.||..|...
Human  1029 VKAEPFENHSALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKLEKNERTPYIMKTTKHFNDISNLI 1093

  Fly   222 VQEILNAEQPKQRAEIITHFIKVAKKLHELNNLHSLFAIISAMQSASIYRLTKTWACLSKKDRNA 286
            ..||:..|....|...|..::.||.....|:|.:::..|.|:|..::|:||.|||..:||:.:..
Human  1094 ASEIIRNEDINARVSAIEKWVAVADICRCLHNYNAVLEITSSMNRSAIFRLKKTWLKVSKQTKAL 1158

  Fly   287 FDRLSDIFSDQDNWANLRSYLESLRLPCIPYLGLFLTDLIYIDLAHPH--KGGLEPEQRRNKMNN 349
            .|:|..:.|.:..:.|||..|::...||:||||::||||.:|:...|:  :.||....:...:::
Human  1159 IDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDGLVNFSKMRMISH 1223

  Fly   350 ILRVISNYQQSNYKHLQKHEATQKYLTSIRYIEELQNIFEEDQYKRSLNLEPASPS 405
            |:|.|..:||:.||...:.:.|| ||....::.:     ||..|:.||.:||..|:
Human  1224 IIREIRQFQQTAYKIEHQAKVTQ-YLLDQSFVMD-----EESLYESSLRIEPKLPT 1273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5522NP_725613.1 RasGEF 163..400 CDD:214539 80/246 (33%)
PH_RalGPS1_2 578..692 CDD:270120
PH 578..685 CDD:278594
RASGRF1NP_002882.3 PH 489..583 CDD:278594
RasGEF_N 647..>695 CDD:279012
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 724..754
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 809..874 16/77 (21%)
REM <938..1007 CDD:295342 3/68 (4%)
RasGEF 1034..1270 CDD:214539 79/241 (33%)
PH_RasGRF1_2 19..154 CDD:270081
PH 24..129 CDD:278594
RhoGEF 244..425 CDD:214619
PH-like 431..582 CDD:302622
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.