DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5522 and RALGDS

DIOPT Version :9

Sequence 1:NP_725613.1 Gene:CG5522 / 36881 FlyBaseID:FBgn0034158 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_006257.1 Gene:RALGDS / 5900 HGNCID:9842 Length:914 Species:Homo sapiens


Alignment Length:582 Identity:139/582 - (23%)
Similarity:212/582 - (36%) Gaps:165/582 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KPTTDYNGYTGQAYAATQFKQSSPPPPPS-QQQQQPT-------RVSKQRSPNTNGSAHTMACLR 80
            |||.:..      .|.|..:..||.|.|: :.:..||       .|:...:|....:......| 
Human   268 KPTPELE------LALTPARAPSPVPAPAPEPEPAPTPAPGSELEVAPAPAPELQQAPEPAVGL- 325

  Fly    81 QEKTYKEQQMEP-PSMQPQASKTLNIKSTRRKNSIGCLNSFSSSPDSPGCYYTIAASAAPPSKSQ 144
            :.......::|| |...|..|:||.::                           .|.|..||...
Human   326 ESAPAPALELEPAPEQDPAPSQTLELE---------------------------PAPAPVPSLQP 363

  Fly   145 SLPAHASIKQ-LDAVILSALRVPADVLANQITLLDFPVFAQIQPDELSSCAWTKKDK----HVNT 204
            |.|:....:. |.......|..|.|::|.|.||:|..:|.::.|.......|:::||    |: .
Human   364 SWPSPVVAENGLSEEKPHLLVFPPDLVAEQFTLMDAELFKKVVPYHCLGSIWSQRDKKGKEHL-A 427

  Fly   205 PNIVAFTKRFNHTSFWTVQEILNAEQPK--QRAEIITHFIKVAKKLHELNNLHSLFAIISAMQSA 267
            |.|.|...:||..:...:...|.....|  .||.::.|:|:||::...|.|..||:||:||:||.
Human   428 PTIRATVTQFNSVANCVITTCLGNRSTKAPDRARVVEHWIEVARECRILKNFSSLYAILSALQSN 492

  Fly   268 SIYRLTKTWACLSKKDRNAFDRLSDIFSDQDNWANLRSYL----------------ESLRLP--- 313
            ||:||.|||..:|:.....|.:||:||||::|::..|..|                .:.:.|   
Human   493 SIHRLKKTWEDVSRDSFRIFQKLSEIFSDENNYSLSRELLIKEGTSKFATLEMNPKRAQKRPKET 557

  Fly   314 -----CIPYLGLFLTDLIYIDLAHPH--KGGLEPEQRRNKMNNILRVISNYQQ--SNYKHLQKHE 369
                 .:||||.|||||:.:|.|...  .|.|...::|.|...::..|...|.  :||    ...
Human   558 GIIQGTVPYLGTFLTDLVMLDTAMKDYLYGRLINFEKRRKEFEVIAQIKLLQSACNNY----SIA 618

  Fly   370 ATQKYLTSIRYIEELQNIFEEDQYKRSLNLEPASPS----------------------------- 405
            ..:::....|.:|.|.   |.:.|..|..|||.|.|                             
Human   619 PDEQFGAWFRAVERLS---ETESYNLSCELEPPSESASNTLRTKKNTAIVKRWSDRQAPSTELST 680

  Fly   406 --------------GP---------------SSSSCSSKESFNVEVV------------------ 423
                          ||               :.||.|..|..|:..|                  
Human   681 SGSSHSKSCDQLRCGPYLSSGDIADALSVHSAGSSSSDVEEINISFVPESPDGQEKKFWESASQS 745

  Fly   424 TPALGCLNLSPAKTIGSMRMASGTKFVPGHRKCRSL-GTKFRSSSLPRNFAEKCQCCIVMIA 484
            :|...  .:|.|.:..|...||.|.........||: |....||:||....:...|||:.::
Human   746 SPETS--GISSASSSTSSSSASTTPVAATRTHKRSVSGLCNSSSALPLYNQQVGDCCIIRVS 805

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5522NP_725613.1 RasGEF 163..400 CDD:214539 81/270 (30%)
PH_RalGPS1_2 578..692 CDD:270120
PH 578..685 CDD:278594
RALGDSNP_006257.1 RasGEFN 112..248 CDD:214571
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..365 20/112 (18%)
RasGEF 382..644 CDD:238087 81/269 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 666..689 0/22 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 728..776 7/49 (14%)
RalGDS_RA 798..883 CDD:176351 3/8 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.