DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5522 and RGL2

DIOPT Version :9

Sequence 1:NP_725613.1 Gene:CG5522 / 36881 FlyBaseID:FBgn0034158 Length:702 Species:Drosophila melanogaster
Sequence 2:XP_024302273.1 Gene:RGL2 / 5863 HGNCID:9769 Length:816 Species:Homo sapiens


Alignment Length:602 Identity:129/602 - (21%)
Similarity:205/602 - (34%) Gaps:212/602 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 SPDSPGCYYTIAASAAPPSKSQSLPAHASIKQLDAVILSALRVPADVLANQITLLDFPVFAQIQP 187
            :||.|              |..:||........|.::..     ||.||.|:||||..:|..:.|
Human   219 APDLP--------------KPLALPGDPPADPTDVLVFL-----ADHLAEQLTLLDAELFLNLIP 264

  Fly   188 DELSSCAWTKKDK----HVNTPNIVAFTKRFNHTSFWTVQEILNAE--------------QPKQR 234
            .:.....|..:|:    |: .|::.|...:||..:...|..:|.|.              :|.||
Human   265 SQCLGGLWGHRDRPGHSHL-CPSVRATVTQFNKVAGAVVSSVLGATSTGEGPGEVTIRPLRPPQR 328

  Fly   235 AEIITHFIKVAKKLHELNNLHSLFAIISAMQSASIYRLTKTWACLSKKDRNAFDRLSDIFSDQDN 299
            |.::..:|:||::...|.|..|::|::||:||:.|:||...|...::.....|..|..|||::||
Human   329 ARLLEKWIRVAEECRLLRNFSSVYAVVSALQSSPIHRLRAAWGEATRDSLRVFSSLCQIFSEEDN 393

  Fly   300 WANLRSYL------------ESLRLP--------CIPYLGLFLTDLIYIDLAHPH--KGGLEPEQ 342
            ::..|..|            .|.:.|        .:||||.||.||:.:|.|...  :.|.....
Human   394 YSQSRELLVQEVKLQSPLEPHSKKAPRSGSRGGGVVPYLGTFLKDLVMLDAASKDELENGYINFD 458

  Fly   343 RRNKMNNI------------------------------------------LRVISNYQQSNYKHL 365
            :|.|::.:                                          ||.:.|  :....:|
Human   459 KRRKVSGVSGLDAGLPYPCSRKGRGKSQGSLSFGSCSLRAPSQEFAVLSELRRLQN--ECRGYNL 521

  Fly   366 QKHEATQKYLTSIRYIEELQNIFEEDQYKRSLNLEPASPSGPSSS---------SCSSKESFNVE 421
            |.....|::|..:|.:.|.|:      ::.|..:||...|.|.:.         |..::...:|.
Human   522 QPDHDIQRWLQGLRPLTEAQS------HRVSCEVEPPGSSDPPAPRVLRPTLVISQWTEVLGSVG 580

  Fly   422 VVTPALGC---------LNLSPAKTIGSMRMASGTKFVPGHRKCRSLGTKFRSSSLPRNFAEKCQ 477
            |.||.:.|         ...:||..:  .|:|...|:    ....||.:...||           
Human   581 VPTPLVSCDRPSTGGDEAPTTPAPLL--TRLAQHMKW----PSVSSLDSALESS----------- 628

  Fly   478 CCIVMIAPGIGTISNKRCRCRRIFGKIATHNHSDGHPHHLHLELDPSQVQPRHHLLDDSVLEHSD 542
                   |.:                     ||...|.|    |.|....||     .|......
Human   629 -------PSL---------------------HSPADPSH----LSPPASSPR-----PSRGHRRS 656

  Fly   543 ALSQADLT-SLESAEGIMCDFTG----------SDCDLMSPEAAAAMHGCVRR------------ 584
            |...:.|: ..|.|.|    .||          |||.::..:......|.|.:            
Human   657 ASCGSPLSGGAEEASG----GTGYGGEGSGPGASDCRIIRVQMELGEDGSVYKSILVTSQDKAPS 717

  Fly   585 ---KTVQKEGRKPAVAS 598
               :.::|..|..||||
Human   718 VISRVLKKNNRDSAVAS 734

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5522NP_725613.1 RasGEF 163..400 CDD:214539 75/318 (24%)
PH_RalGPS1_2 578..692 CDD:270120 8/36 (22%)
PH 578..685 CDD:278594 8/36 (22%)
RGL2XP_024302273.1 RasGEFN 90..212 CDD:214571
RasGEF 239..552 CDD:214539 76/326 (23%)
RalGDS_RA 687..772 CDD:176351 10/48 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.