DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5522 and rasgrf1

DIOPT Version :9

Sequence 1:NP_725613.1 Gene:CG5522 / 36881 FlyBaseID:FBgn0034158 Length:702 Species:Drosophila melanogaster
Sequence 2:XP_009291904.1 Gene:rasgrf1 / 568885 ZFINID:ZDB-GENE-090311-28 Length:1263 Species:Danio rerio


Alignment Length:390 Identity:107/390 - (27%)
Similarity:179/390 - (45%) Gaps:43/390 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PTTDYNGYTGQAYAATQFKQSSPPPPPSQQQQQPTRVSKQRSPN--TNGSAHTMACLRQE-KTYK 86
            ||.:  .|...:.|:|.|       |..|:......|.::.:.|  .|...|.::...|: :|..
Zfish   908 PTKE--KYRRMSLASTGF-------PTDQRNGDKEFVIRRAATNRVLNVLRHWVSKHSQDFETNT 963

  Fly    87 EQQMEPPSMQPQASKTLNIKSTRRKNSIGCLNSFSSSPDSPG----CYYTIAASAAPPSKSQSLP 147
            |.:|:..|...:......:.:..||.:...:.:.:.  :.||    |...: ...|...||:|..
Zfish   964 ELKMKVISFLEEVMHDPELLTQERKAAANIIRTLTQ--EDPGDNQICLEEV-LQMAEGGKSESFE 1025

  Fly   148 AHASIKQLDAVILSALRVPADVLANQITLLDFPVFAQIQPDELSSCAWTKKDKHVNTPNIVAFTK 212
            .|::::                :|.|:||||..||..|..:|.....|.|.||:..||.|:..||
Zfish  1026 NHSALE----------------IAEQLTLLDHLVFKVIPYEEFFGQGWMKNDKNEKTPYIMKTTK 1074

  Fly   213 RFNHTSFWTVQEILNAEQPKQRAEIITHFIKVAKKLHELNNLHSLFAIISAMQSASIYRLTKTWA 277
            .||..|.....|||..|....|..::..::.||.....|:|.:::..|.|::..:||:||.|||.
Zfish  1075 HFNDISDLIATEILRCEDVNVRVAVMEKWVAVADICRCLHNYNAVLEITSSLNRSSIFRLKKTWL 1139

  Fly   278 CLSKKDRNAFDRLSDIFSDQDNWANLRSYLESLRLPCIPYLGLFLTDLIYIDLAHPH--KGGLEP 340
            .:||:.:...|:|..:.|.:..:.|||..|::...||:||||::||||.:|:...|:  :..|..
Zfish  1140 KVSKQTKTVIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDNLVN 1204

  Fly   341 EQRRNKMNNILRVISNYQQSNYKHLQKHEATQKYLTSIRYIEELQNIFEEDQYKRSLNLEPASPS 405
            ..:...:::|:|.|..:||:.|| :........||.....:.|     ||..|:.||.:||..|:
Zfish  1205 FSKMRMISHIIREIRQFQQTAYK-IDYQPKAALYLLDRSAVME-----EEGLYEASLRIEPKVPN 1263

  Fly   406  405
            Zfish  1264  1263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5522NP_725613.1 RasGEF 163..400 CDD:214539 77/238 (32%)
PH_RalGPS1_2 578..692 CDD:270120
PH 578..685 CDD:278594
rasgrf1XP_009291904.1 PH_RasGRF1_2 19..154 CDD:270081
PH 24..129 CDD:278594
RhoGEF 244..425 CDD:214619
PH-like 474..596 CDD:302622
PH 489..592 CDD:278594
RasGEF_N 643..>691 CDD:279012
REM <928..997 CDD:295342 11/68 (16%)
RasGEF 1024..1261 CDD:214539 80/258 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.