DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5522 and rasgrf2a

DIOPT Version :9

Sequence 1:NP_725613.1 Gene:CG5522 / 36881 FlyBaseID:FBgn0034158 Length:702 Species:Drosophila melanogaster
Sequence 2:XP_009303357.1 Gene:rasgrf2a / 558859 ZFINID:ZDB-GENE-111128-1 Length:1274 Species:Danio rerio


Alignment Length:432 Identity:118/432 - (27%)
Similarity:177/432 - (40%) Gaps:94/432 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SRKPTTD----YNGYTGQ---------------AYAATQFKQSSPP----PPPSQQQQQPTR--- 60
            ||.|:|.    |....||               |.|......|||.    |..|..::...|   
Zfish   885 SRSPSTPRHLRYRQPAGQCPDNSRCAVSPASAFAIATAAAGHSSPQGFTNPEKSYDKEFLIRRAA 949

  Fly    61 -----------VSKQRSP---NTNGSAHTMACLRQEKTYKEQQMEPPSMQPQASKTLNIKSTRRK 111
                       |||....   |...:...||.|       |:.:..|.:.||          .||
Zfish   950 TNRVLNVLRHWVSKHSQDFEMNAELTTAVMALL-------EEVLRDPDLLPQ----------ERK 997

  Fly   112 NSIGCLNSFSSSPDSPGCYYTIAASAAPPSKSQSLPAHASIKQLDA------VILSALRVPADVL 170
            .::..|::.|.....                ...|.....::.:|.      ..|||:.     |
Zfish   998 AAVNILSALSQEEQD----------------DSQLKIEDIVQMVDCPRAECFESLSAME-----L 1041

  Fly   171 ANQITLLDFPVFAQIQPDELSSCAWTKKDKHVNTPNIVAFTKRFNHTSFWTVQEILNAEQPKQRA 235
            |.||||||..||..|..:|.....|.|.||:..||.|:..::.||..|.....||:.......||
Zfish  1042 AEQITLLDHIVFRNIPYEEFLGQGWMKMDKNERTPYIMKTSQHFNDMSNLVASEIMAHADVSSRA 1106

  Fly   236 EIITHFIKVAKKLHELNNLHSLFAIISAMQSASIYRLTKTWACLSKKDRNAFDRLSDIFSDQDNW 300
            ..|..::.||.....|||.:.:..|.||:..::||||.||||.:.|:.:...|||..|.|.:..:
Zfish  1107 GSIDKWLAVADICRCLNNYNGVLEITSALNRSAIYRLKKTWAKVCKQTKALMDRLQKIVSSEGRF 1171

  Fly   301 ANLRSYLESLRLPCIPYLGLFLTDLIYIDLAHPH--KGGLEPEQRRNKMNNILRVISNYQQSNYK 363
            .|||..|::...||:||||::||||.:|:...|:  :.||....:...:::|:|.|..:||:.|:
Zfish  1172 KNLRETLKNCNPPCVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQAPYR 1236

  Fly   364 HLQKHEATQKYLTSIRYIEELQNIFEEDQ-YKRSLNLEPASP 404
            ...:.:.||       ::.:...:.:||. |:.||.:||..|
Zfish  1237 IELQPKVTQ-------FLLDKTLVMDEDTLYELSLKIEPRLP 1271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5522NP_725613.1 RasGEF 163..400 CDD:214539 80/239 (33%)
PH_RalGPS1_2 578..692 CDD:270120
PH 578..685 CDD:278594
rasgrf2aXP_009303357.1 PH_RasGRF1_2 19..155 CDD:270081
PH 24..130 CDD:278594
RhoGEF 244..425 CDD:279015
PH 478..585 CDD:214574
PH 489..584 CDD:278594
RasGEF_N 635..>683 CDD:279012
REM <935..1007 CDD:295342 17/88 (19%)
RasGEF 1033..1265 CDD:238087 82/243 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.