DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5522 and rapgef1a

DIOPT Version :9

Sequence 1:NP_725613.1 Gene:CG5522 / 36881 FlyBaseID:FBgn0034158 Length:702 Species:Drosophila melanogaster
Sequence 2:XP_005166961.1 Gene:rapgef1a / 558635 ZFINID:ZDB-GENE-081105-26 Length:1085 Species:Danio rerio


Alignment Length:281 Identity:79/281 - (28%)
Similarity:131/281 - (46%) Gaps:51/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 TIAAS--AAPPSKSQSLPAHASIKQLDAVILSALRVPADVLANQITLLDFPVFAQIQPDELSSCA 194
            |:||.  ||.|.......:|.                   :|:|:||||..:|.:|:..|:  ..
Zfish   831 TLAARGVAARPGTLHDFRSHE-------------------IADQLTLLDAELFYKIEIPEV--LL 874

  Fly   195 WTKKDKHVNTPNIVAFTKRFNHTSFWTVQEILNAEQPKQRAEIITHFIKVAKKLHELNNLHSLFA 259
            |.|:.....:||:..||:.||:.|:|....|:..|:.:.|.:::..|||:.|.|.:|||.:|..|
Zfish   875 WAKEQNEEKSPNLTQFTEHFNNMSYWVRSIIILQEKAQDREKLLLKFIKIMKHLRKLNNFNSYLA 939

  Fly   260 IISAMQSASIYRLTKTWACLSKKDRNAFDRLSDIFSDQDNWANLRSYLESLRLPCIPYLGLFLTD 324
            |:||:.||.|.||  .|   .|:.....:....:.....::...|:.|..:..||||||||.|.|
Zfish   940 ILSALDSAPIRRL--EW---QKQTSEGLEEYCTLIDSSSSFRAYRAALADVEPPCIPYLGLILQD 999

  Fly   325 LIYIDLAHP-HKGGLEPEQRRNKMNNILRVISNYQQSNYKHLQKHEATQKYLTSIRYIEELQNIF 388
            |.::.|.:| |..|.....:|.:..|||..:..:||.:|              .:::.:::.:.|
Zfish  1000 LTFVHLGNPDHIEGKINFSKRWQQFNILDTMRRFQQVHY--------------DLKHNDDIVSFF 1050

  Fly   389 --------EEDQYKRSLNLEP 401
                    ||..::.||.::|
Zfish  1051 NDFSDHLAEEALWELSLKIKP 1071

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5522NP_725613.1 RasGEF 163..400 CDD:214539 71/245 (29%)
PH_RalGPS1_2 578..692 CDD:270120
PH 578..685 CDD:278594
rapgef1aXP_005166961.1 RasGEFN 696..837 CDD:214571 3/5 (60%)
RasGEF 844..1073 CDD:214539 73/268 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.