DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5522 and RAPGEF6

DIOPT Version :9

Sequence 1:NP_725613.1 Gene:CG5522 / 36881 FlyBaseID:FBgn0034158 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_001157858.1 Gene:RAPGEF6 / 51735 HGNCID:20655 Length:1609 Species:Homo sapiens


Alignment Length:513 Identity:129/513 - (25%)
Similarity:196/513 - (38%) Gaps:124/513 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 LSALRVPADVLANQITLLDFPVFAQIQPDELSSCAWTKKDKHVNTPNIVAFTKRF----NHTSFW 220
            ||.|::....:|.|:::.||.:|..|:|.|.....:....|..||     ..|||    |..:||
Human   854 LSMLQLSTIEVATQLSMRDFDLFRNIEPTEYIDDLFKLNSKTGNT-----HLKRFEDIVNQETFW 913

  Fly   221 TVQEILNAEQPKQRAEIITHFIKVAKKLHELNNLHSLFAIISAMQSASIYRLTKTWACLSKKDRN 285
            ...|||......:|.:||.||||:|....|..|.:|:|||||.:..||:.||..||..|..|...
Human   914 VASEILTEANQLKRMKIIKHFIKIALHCRECKNFNSMFAIISGLNLASVARLRGTWEKLPSKYEK 978

  Fly   286 AFDRLSDIFSDQDNWANLRSYL--ESLRLPCIPYLGLFLTDLIYIDLAHPHKG------------ 336
            ....|.|||....|.|..|:.|  :|::.|.||...:...|:.::     |:|            
Human   979 HLQDLQDIFDPSRNMAKYRNILSSQSMQPPIIPLFPVVKKDMTFL-----HEGNDSKVDGLVNFE 1038

  Fly   337 ------------------GLEP----EQRRNKMNNILRVISNYQQSNYKHLQ-----KHEATQKY 374
                              .::|    .||:.:..::..:......||...:|     |.......
Human  1039 KLRMISKEIRQVVRMTSANMDPAMMFRQRKKRWRSLGSLSQGSTNSNMLDVQGGAHKKRARRSSL 1103

  Fly   375 LTSIRYIEELQNIFEEDQYKRSLNLEPASPSGPSSSSCSSKESFNVEVV--TPALGCL--NLSPA 435
            |.:.:..|:.|...:..||..||::|            :.:|.|.:..:  .||.|.|  |||..
Human  1104 LNAKKLYEDAQMARKVKQYLSSLDVE------------TDEEKFQMMSLQWEPAYGTLTKNLSEK 1156

  Fly   436 KTIGSMRMASGTKFVPGHRKCRSLGTKFRSS-SLPRNFAEKCQCCIVMIAP-------------- 485
            ::..|..|:.    ||    .||.|...::. ..|...::..|...|.:.|              
Human  1157 RSAKSSEMSP----VP----MRSAGQTTKAHLHQPHRVSQVLQVPAVNLHPIRKKGQTKDPALNT 1213

  Fly   486 -----GIGT---ISNKRCRCRRIFGKIATHNHS------DGHPHHLHLELDPSQVQPRHHLLDDS 536
                 .:||   ||.|:.....|  .:|:..||      .|.||..: .|.||   .:...|.||
Human  1214 SLPQKVLGTTEEISGKKHTEDTI--SVASSLHSSPPASPQGSPHKGY-TLIPS---AKSDNLSDS 1272

  Fly   537 VLEHSDALSQADLT---SLESAEGIMCDFTGSDCDLMSPEAAAAMHGCVRRKTVQKEG 591
              .||:..|::.:.   |::|....:.|...|...|..||:..|:     .||....|
Human  1273 --SHSEISSRSSIVSNCSVDSMSAALQDERCSSQALAVPESTGAL-----EKTEHASG 1323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5522NP_725613.1 RasGEF 163..400 CDD:214539 74/281 (26%)
PH_RalGPS1_2 578..692 CDD:270120 3/14 (21%)
PH 578..685 CDD:278594 3/14 (21%)
RAPGEF6NP_001157858.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
CAP_ED 37..>82 CDD:294041
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..250
Crp 274..>448 CDD:223736
CAP_ED 280..380 CDD:237999
RasGEFN 412..525 CDD:214571
PDZ_signaling 529..609 CDD:238492
UBQ 749..833 CDD:294102
RasGEF 857..1081 CDD:238087 63/233 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1200..1282 21/89 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1310..1332 5/19 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1463..1486
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1579..1609
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.