DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5522 and rapgef1b

DIOPT Version :9

Sequence 1:NP_725613.1 Gene:CG5522 / 36881 FlyBaseID:FBgn0034158 Length:702 Species:Drosophila melanogaster
Sequence 2:XP_021324455.1 Gene:rapgef1b / 394101 ZFINID:ZDB-GENE-040426-1001 Length:1204 Species:Danio rerio


Alignment Length:258 Identity:77/258 - (29%)
Similarity:131/258 - (50%) Gaps:26/258 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 LSALRVPA----------DVLANQITLLDFPVFAQIQPDELSSCAWTKKDKHVNTPNIVAFTKRF 214
            |:||.|.|          ..:|:|:||||..:|.:|:..|:  ..|.|:.....:||:..||:.|
Zfish   951 LAALGVSARPGTLHDFRSHEIADQLTLLDAELFYKIEIPEV--LLWAKEQNEEKSPNLTQFTEHF 1013

  Fly   215 NHTSFWTVQEILNAEQPKQRAEIITHFIKVAKKLHELNNLHSLFAIISAMQSASIYRLTKTWACL 279
            |:.|:|....|:..|:.:.|.:::..|||:.|.|.:|||.:|..||:||:.||.|.||  .|   
Zfish  1014 NNMSYWVRSIIIQQEKAQDREKLLLKFIKIMKHLRKLNNFNSYLAILSALDSAPIRRL--EW--- 1073

  Fly   280 SKKDRNAFDRLSDIFSDQDNWANLRSYLESLRLPCIPYLGLFLTDLIYIDLAHPH--KGGLEPEQ 342
            .|:.....:....:.....::...|:.|..:..||||||||.|.||.::.|.:|.  :|.:...:
Zfish  1074 QKQTSEGLEEYCTLIDSSSSFRAYRAALAEVEPPCIPYLGLILQDLTFVHLGNPDFIEGKVNFSK 1138

  Fly   343 RRNKMNNILRVISNYQQSNYKHLQKHEATQKYLTSIRYIEELQNIFEEDQYKRSLNLEPASPS 405
            |..:. |||..:..:||.:| .|::::....:.....     .::.||..::.||.::|.:.|
Zfish  1139 RWQQF-NILDSMRRFQQVHY-DLKRNDDIVSFFNDFS-----DHLAEEALWELSLKIKPRNIS 1194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5522NP_725613.1 RasGEF 163..400 CDD:214539 73/248 (29%)
PH_RalGPS1_2 578..692 CDD:270120
PH 578..685 CDD:278594
rapgef1bXP_021324455.1 Atrophin-1 <287..538 CDD:331285
RasGEFN 815..953 CDD:214571 1/1 (100%)
RasGEF 963..1192 CDD:214539 71/242 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.