DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5522 and CG4853

DIOPT Version :9

Sequence 1:NP_725613.1 Gene:CG5522 / 36881 FlyBaseID:FBgn0034158 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_611222.2 Gene:CG4853 / 36974 FlyBaseID:FBgn0034230 Length:709 Species:Drosophila melanogaster


Alignment Length:297 Identity:75/297 - (25%)
Similarity:126/297 - (42%) Gaps:46/297 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 SKSQSLPAHASIKQLDAVILSALRV--------PADVLANQITLLDFPVFAQI---------QPD 188
            |.:.||...:|||.|.....:..:.        .|..||:|:..:::...:||         :.|
  Fly   402 SSASSLGRQSSIKSLKRFAANVYKTDNVLNNCSSAFELAHQLYAIEYAYLSQIRLEEFVEILEKD 466

  Fly   189 ELSSC-----AWTKKDKHVNTPNIVAFTKRFNHTSFWTVQEILNAEQPKQRAEIITHFIKVAKKL 248
            ||.:|     |.|.....::...|.::.:.||..|:.|..|||...:..|||::|..:::.|.:.
  Fly   467 ELKTCISQTKAGTLGSNCISQVTIDSYVQWFNQLSYLTATEILKLGKKSQRAQMIDFWVETALEC 531

  Fly   249 HELNNLHSLFAIISAMQSASIYRLTKTWACLSKKDRNAFDRLSDIFSDQDNWANLRSYLES---- 309
            ....|.:||.||::|:...:|.||.||||   |.....|:.|........|:.|.||.:::    
  Fly   532 FNTGNFNSLMAILTALNLTAIARLKKTWA---KVQTTKFEGLEHQMDPSSNFLNYRSTMKAAVWR 593

  Fly   310 --------LRLPCIPYLGLFLTDLIYIDLAHPHKGGLEPEQRRNKMNNILRVIS-NYQQSNYKHL 365
                    :....||:..|||.||..|:.:|..|       ..|...|..:.:. ..|..|:...
  Fly   594 SEREMANEIERAIIPFFSLFLKDLHAINESHETK-------LANGYINFEKCLHLGTQLRNFGKW 651

  Fly   366 QKHEATQKYLTS-IRYIEELQNIFEEDQYKRSLNLEP 401
            |:.:...:.|.| :.|:.:.:.:.|:...|.|...||
  Fly   652 QRLDCPYEQLPSVVSYLLKAEVLSEDLLMKASYESEP 688

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5522NP_725613.1 RasGEF 163..400 CDD:214539 66/272 (24%)
PH_RalGPS1_2 578..692 CDD:270120
PH 578..685 CDD:278594
CG4853NP_611222.2 RasGEF_N 288..365 CDD:279012
RasGEF 438..638 CDD:279011 56/209 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467909
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23113
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.