DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5522 and Rasgrp2

DIOPT Version :9

Sequence 1:NP_725613.1 Gene:CG5522 / 36881 FlyBaseID:FBgn0034158 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_001076446.2 Gene:Rasgrp2 / 361714 RGDID:1311630 Length:608 Species:Rattus norvegicus


Alignment Length:562 Identity:129/562 - (22%)
Similarity:209/562 - (37%) Gaps:167/562 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 MEP---PSMQPQASKTLNIKSTRRKNSIGCLNSFSSSPDSPGCYYTIAASAAPPSKSQSLPAHA- 150
            |.|   ||.| .|||.|:.....||::       |:|.....|:......:|.|::....|..| 
  Rat    42 MHPWYIPSSQ-LASKLLHFYQQSRKDN-------SNSLQVKTCHLVRYWVSAFPAEFDLNPELAE 98

  Fly   151 SIKQLDAV-----------ILSALRVPADVLANQITLLDFPV----------FAQIQPDEL---- 190
            .||:|.|:           ::....||......|:|..: ||          |..::|.||    
  Rat    99 QIKELKALLDQEGNRRHSSLIDIESVPTYKWKRQVTQRN-PVEQKKRKMSLLFDHLEPMELAEHL 162

  Fly   191 ------SSCAWTKKDKH--------VNTPNIVAFTKRFNHTSFWTVQEILNAEQPKQRAEIITHF 241
                  |.|....:|.|        |:.|.:..|...||..|.|....||:.....|||.:||||
  Rat   163 TYLEYRSFCKILFQDYHSFVTHGCTVDNPVLERFISLFNSVSQWVQLMILSKPTATQRALVITHF 227

  Fly   242 IKVAKKLHELNNLHSLFAIISAMQSASIYRLTKTWACLSKKDRNAFDRLSDIFSDQDNWANLRSY 306
            :.||:||.:|.|.::|.|::..:..:||.||.:|.:.:|......::.|:::.:...|::|.|..
  Rat   228 VHVAEKLLQLQNFNTLMAVVGGLSHSSISRLKETHSHVSPDTIKLWEGLTELVTATGNYSNYRRR 292

  Fly   307 LESLRLPCI----PYLGLFLTDLIYIDLAHPHKGGLEPEQRR---NKMNNILRVISNYQQSNYKH 364
            |.:    |:    |.||:.|.||:.:.||.|  ..|:|.:.|   .||..:..::.  :.:....
  Rat   293 LAA----CVGFRFPILGVHLKDLVALQLALP--DWLDPGRTRLNGAKMRQLFSILE--ELAMVTS 349

  Fly   365 LQKHEATQKYLTSIRYIEELQNIFEEDQYKRSLNLEPASPSGPSS-SSCS--------------- 413
            |:........|.|:..:...|...|::.|:.||..||.|.|.|:| :||:               
  Rat   350 LRPPVQANPDLLSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLEEWTSVA 414

  Fly   414 --------------------------------SKESFNV------------EVVTPALGCLN--- 431
                                            |:|.|.:            ::.....||::   
  Rat   415 KPKLDQALVAEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREE 479

  Fly   432 -----LSPAKTIGSMRMASGTKFVPGH-------RKCRSLGTKFRSSSLPRNFAEKCQCCIVMIA 484
                 |..:..:|. ||.....|...:       |.|::|........|      ||:.|     
  Rat   480 MISYFLRSSSVLGG-RMGFVHNFQESNSLRPVACRHCKALILGIYKQGL------KCRAC----- 532

  Fly   485 PGIGTISNKRCR------CRRIFGKIATH----NHSDGHPHH 516
               |...:|:|:      |||....::..    :.|..|.||
  Rat   533 ---GVNCHKQCKDRLSVECRRRAQSVSLEGSAPSPSPTHTHH 571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5522NP_725613.1 RasGEF 163..400 CDD:214539 72/271 (27%)
PH_RalGPS1_2 578..692 CDD:270120
PH 578..685 CDD:278594
Rasgrp2NP_001076446.2 RasGEFN 7..121 CDD:214571 22/86 (26%)
RasGEF 150..387 CDD:214539 67/244 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 382..405 9/22 (41%)
EFh 430..481 CDD:238008 5/50 (10%)
C1_RASGRP2 496..551 CDD:410411 13/68 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 555..596 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.