DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5522 and Epac

DIOPT Version :9

Sequence 1:NP_725613.1 Gene:CG5522 / 36881 FlyBaseID:FBgn0034158 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_001097202.2 Gene:Epac / 35588 FlyBaseID:FBgn0085421 Length:1006 Species:Drosophila melanogaster


Alignment Length:262 Identity:66/262 - (25%)
Similarity:112/262 - (42%) Gaps:41/262 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 LDAVILSALRVPADVLANQITLLDFPVFAQIQPDELSSCAWTKKDKHVNTPNIVAFTKRFNHTSF 219
            :|..|||...     ||..|||.::.:|..:...||....:.:......|.|:..|.:|||...:
  Fly   761 IDLEILSTKE-----LAYHITLFEWDLFWAVHEYELLYHTFGRHHFGKITANLDVFLRRFNEVQY 820

  Fly   220 WTVQEILNAEQPKQRAEIITHFIKVAKKLHELNNLHSLFAIISAMQSASIYRLTKTWACLSKKDR 284
            |.|.|:::.....:|..::..|||:|....|..||::.||::..:.:.::.||.:||..:..|.|
  Fly   821 WIVTELVSTPSLSKRVGLVRKFIKLAAYCKEYQNLNAFFAVVMGLSNMAVSRLQQTWEKIPSKFR 885

  Fly   285 NAFDRLSDIFSDQDNWANLRSYLESLRLPCIPYLGLFLTDLIYIDLAHPHKGGLEPEQRRNKMNN 349
            ..|.....:.....|....|.::..|:.|.||::.|.|.|:.:   ||        |..:..::.
  Fly   886 KIFQEFEALIDPSRNHRAYRVFVGKLQPPLIPFMPLLLKDMTF---AH--------EGNKTSLDG 939

  Fly   350 ILRVISNYQQSNYKHLQKHEATQKYLTSIRYIEELQNIFEEDQYKRSLNLEPASP--SGPSSSSC 412
            ::         |::.:.....|.:   :||:..           .|||.|||.||  .|...|..
  Fly   940 LV---------NFEKMHMMAQTMR---TIRFCR-----------SRSLGLEPPSPKSEGEVRSYI 981

  Fly   413 SS 414
            ||
  Fly   982 SS 983

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5522NP_725613.1 RasGEF 163..400 CDD:214539 53/236 (22%)
PH_RalGPS1_2 578..692 CDD:270120
PH 578..685 CDD:278594
EpacNP_001097202.2 Crp 28..>146 CDD:223736
CAP_ED 36..146 CDD:237999
DEP_Epac 199..330 CDD:239884
CAP_ED 352..463 CDD:237999
Crp 373..525 CDD:223736
RasGEF_N 489..594 CDD:279012
UBQ 665..>714 CDD:294102
RasGEF 766..1002 CDD:214539 64/257 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467916
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23113
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.