DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5522 and Sos

DIOPT Version :9

Sequence 1:NP_725613.1 Gene:CG5522 / 36881 FlyBaseID:FBgn0034158 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_476597.2 Gene:Sos / 34790 FlyBaseID:FBgn0001965 Length:1596 Species:Drosophila melanogaster


Alignment Length:480 Identity:120/480 - (25%)
Similarity:207/480 - (43%) Gaps:93/480 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 SMQPQASKTLNI---KSTRRKNSIGCLNSFSSSPDSPGCYYTIAASAAPPSKSQSLPAHASIKQL 155
            ||:......|.|   |:.:.|::...:.::...|              ||     :..|.|:.. 
  Fly   776 SMRKWVDSVLKIVQRKNEQEKSNKKIVYAYGHDP--------------PP-----IEHHLSVPN- 820

  Fly   156 DAVILSALRVPADVLANQITLLDFPVFAQIQPDELSSCAWTKKDKHVNTPNIVAFTKRFNHTSFW 220
            |.:.|..|. |.: ||.|:|||:|.::..::|.||....||||||.|.:||::...|...:.:.|
  Fly   821 DEITLLTLH-PLE-LARQLTLLEFEMYKNVKPSELVGSPWTKKDKEVKSPNLLKIMKHTTNVTRW 883

  Fly   221 TVQEILNAEQPKQRAEIITHFIKVAKKLHELNNLHSLFAIISAMQSASIYRLTKTWACLSKKDRN 285
            ..:.|..||..::|..|:...|:|...:.||||.:.:.:|::||.:||:|||..|:..|.::.|.
  Fly   884 IEKSITEAENYEERLAIMQRAIEVMMVMLELNNFNGILSIVAAMGTASVYRLRWTFQGLPERYRK 948

  Fly   286 AFDRLSDIFSDQDNWANLRSYLESLRL---PCIPYLGLFLTDLIYIDLAHPH---KGGLEPEQRR 344
            ..:...::..|     :|:.|.|.||.   ||:|:.|.:||::::::..:|.   ...|....:|
  Fly   949 FLEECRELSDD-----HLKKYQERLRSINPPCVPFFGRYLTNILHLEEGNPDLLANTELINFSKR 1008

  Fly   345 NKMNNILRVISNYQQSNYKHLQKHEATQKYLTSIRYIEELQ--NIFEEDQ-----YKRSLNLEPA 402
            .|:..|:..|..||  |..:....|:|.:     ::.|:|.  |...:.|     |..||.:|| 
  Fly  1009 RKVAEIIGEIQQYQ--NQPYCLNEESTIR-----QFFEQLDPFNGLSDKQMSDYLYNESLRIEP- 1065

  Fly   403 SPSGPSSSSCSSKESF-----NVEVVTPALGCLNLSPAK---TIGSMRMASGTKFVPGHRKCRSL 459
                   ..|.:...|     ::.:.:|     .:.|.:   |..|.::::.|..|.......|.
  Fly  1066 -------RGCKTVPKFPRKWPHIPLKSP-----GIKPRRQNQTNSSSKLSNSTSSVAAAAAASST 1118

  Fly   460 GTKFRSSSLPRNFAEKCQCCIVMIAP-------GIGTISNKRC-----RCRRIFGK--IATHNHS 510
            .|...::|.|...|..     :|.||       |.||::.::.     ....:|..  |...|.|
  Fly  1119 ATSIATASAPSLHASS-----IMDAPTAAAANAGSGTLAGEQSPQHNPHAFSVFAPVIIPERNTS 1178

  Fly   511 --DGHPHHLHLELDPSQVQ-PRHHL 532
              .|.|.|...:.:..:|. |..||
  Fly  1179 SWSGTPQHTRTDQNNGEVSVPAPHL 1203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5522NP_725613.1 RasGEF 163..400 CDD:214539 75/249 (30%)
PH_RalGPS1_2 578..692 CDD:270120
PH 578..685 CDD:278594
SosNP_476597.2 Histone 90..216 CDD:278551
H2A 155..>196 CDD:305064
RhoGEF 249..432 CDD:238091
PH_SOS 476..586 CDD:269963
PH 482..587 CDD:278594
RasGEFN 637..791 CDD:214571 4/14 (29%)
RasGEF 825..1062 CDD:238087 75/250 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467923
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3417
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23113
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.