DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5522 and CG34393

DIOPT Version :9

Sequence 1:NP_725613.1 Gene:CG5522 / 36881 FlyBaseID:FBgn0034158 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_001285578.1 Gene:CG34393 / 33534 FlyBaseID:FBgn0085422 Length:691 Species:Drosophila melanogaster


Alignment Length:218 Identity:44/218 - (20%)
Similarity:77/218 - (35%) Gaps:47/218 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 QQQQPTRVSKQ--RSPNTNGSAHTMACLRQEKTYKEQQMEPPSMQPQASKTLNIKSTRRKNSIGC 116
            :||:..:..||  :.|...|:|.|...:....|......|.||...:.:....|.:...:::...
  Fly   491 EQQEGLKTDKQAPKEPAAQGAAPTQGAVAIAITTSSDSDEKPSTSGRVAGIAGISAATMESAPVP 555

  Fly   117 LNSFSSSPDSPGCYYTIAASAAPPSKSQSLPAHASIKQLDAVILSALRVPADVLANQITLLDFPV 181
            :.| .|:.|:     ..||:|...:.:.:.|..:|.|..|.|::                   ||
  Fly   556 VAS-GSNVDA-----ATAAAARTSTTAATTPLASSGKPNDWVVI-------------------PV 595

  Fly   182 FAQIQP---DELSSCAWTKKDKHVN-------TPNIVAFTKRFNHTSFWTVQEILNAEQPKQRAE 236
            ||.|..   .|..:|.....:.|:|       ...:.||||.         .:.:.|.|.....|
  Fly   596 FADIVKLALGERENCLQRLANGHINMAAFDRMAAIVGAFTKH---------MQAMKAAQAPSSGE 651

  Fly   237 IITHFIKVAKKLHELNNLHSLFA 259
             ..||.:..::..:|.....:.|
  Fly   652 -YEHFCRHMQQTTKLGEAELMMA 673

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5522NP_725613.1 RasGEF 163..400 CDD:214539 20/107 (19%)
PH_RalGPS1_2 578..692 CDD:270120
PH 578..685 CDD:278594
CG34393NP_001285578.1 REM 196..300 CDD:100121
RasGEF 334..>473 CDD:279011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23113
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.