DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5522 and Sos1

DIOPT Version :9

Sequence 1:NP_725613.1 Gene:CG5522 / 36881 FlyBaseID:FBgn0034158 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_001094186.1 Gene:Sos1 / 313845 RGDID:1310949 Length:1319 Species:Rattus norvegicus


Alignment Length:598 Identity:129/598 - (21%)
Similarity:230/598 - (38%) Gaps:148/598 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 SKTLNIKSTRRKNSIGCLNSFSSSPDSPGCYYTIAASAAPPSKSQSLPAHASIKQLDAVILSALR 164
            :|.:..|...|.|..|...:|.:||  |...:.|           |.|.|  |:..|.:.|..:.
  Rat   734 TKIIQRKKIARDNGPGHNITFQNSP--PTVEWHI-----------SRPGH--IETFDLLTLHPIE 783

  Fly   165 VPADVLANQITLLDFPVFAQIQPDELSSCAWTKKDKHVNTPNIVAFTKRFNHTSFWTVQEILNAE 229
            :     |.|:|||:..::..:||.||....|||:||.:|:||::...:...:.:.|..:.|:..|
  Rat   784 I-----ARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVETE 843

  Fly   230 QPKQRAEIITHFIKVAKKLHELNNLHSLFAIISAMQSASIYRLTKTWACLSKKDRNAFDRLSDIF 294
            ..::|..:::..|::.:...||||.:.:..::|||.|:.:|||..|:..:..:.:...:...:: 
  Rat   844 NLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQKKILEEAHEL- 907

  Fly   295 SDQDNWANLRSYLESLRLPCIPYLGLFLTDLIYIDLAHP-----HKGGLEPEQRRNKMNNILRVI 354
             .:|::....:.|.|:..||:|:.|::||:::..:..:|     |...|....:|.::..|...|
  Rat   908 -SEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLRRHGKELINFSKRRRVAEITGEI 971

  Fly   355 SNYQQSNYKHLQKHEATQKYLTSIRYIEEL-------QNIFEEDQYKRSLNLEPASPSG----PS 408
            ..||  |..:..:.|:..|     |:.|.|       :..|.:..:.:||.:||.:|..    | 
  Rat   972 QQYQ--NQPYCLRVESDIK-----RFFENLNPMGNSMEKEFTDYLFNKSLEIEPRNPKPLPRFP- 1028

  Fly   409 SSSCSSKESFNVEVVTPALGCLNLSPAKTIGSMRMASGTKFVPGHRKCRSLGTKFRSSSLPRNFA 473
                   :.::..:.:|.:...|..|    |:||..:..:..|         .|...|.:|.:..
  Rat  1029 -------KKYSYPLKSPGVRPSNPRP----GTMRHPTPLQQEP---------RKISYSRIPESET 1073

  Fly   474 EKCQCC-----IVMIAPGIGTISNKRCRCRRIFGKIATHNHSDGH-------------------- 513
            |.....     ..:..|...:.|:....| .:|.  :.|:.|..|                    
  Rat  1074 ESTASAPNSPRTPLTPPPASSASSNTDVC-SVFD--SDHSASPFHSRSASVSSISLSKGTEEVPV 1135

  Fly   514 ---------PHHLHLELDPSQVQPRHHLLDD---------SVLEHSDALSQADLTSLESAEGIMC 560
                     |.....|..||::..:|  ||.         :...:|...|.:|.||:        
  Rat  1136 PPPVPPRRRPESAPAESSPSKIMSKH--LDSPPAIPPRQPTSKAYSPRYSISDRTSI-------- 1190

  Fly   561 DFTGSDCDLMSPEAAAAMHGCVRRKTVQKEGRKPAVASWQRYWLQIWANSLVYFPPKSFKGSERN 625
                ||    .||:...:   ..|:.|    |.|.|.|.....||         ||...|.|:..
  Rat  1191 ----SD----PPESPPLL---PPREPV----RTPDVFSSSPLHLQ---------PPPLGKKSDHG 1231

  Fly   626 D--FKREPCKVCP 636
            :  |...|....|
  Rat  1232 NAFFPNSPSPFTP 1244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5522NP_725613.1 RasGEF 163..400 CDD:214539 60/248 (24%)
PH_RalGPS1_2 578..692 CDD:270120 15/61 (25%)
PH 578..685 CDD:278594 15/61 (25%)
Sos1NP_001094186.1 H2A 97..177 CDD:305064
RhoGEF 204..389 CDD:214619
PH_SOS 439..545 CDD:269963
PH 445..546 CDD:278594
RasGEFN 597..741 CDD:214571 1/6 (17%)
RasGEF 776..1015 CDD:238087 60/252 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.