DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5522 and Rasgef1a

DIOPT Version :9

Sequence 1:NP_725613.1 Gene:CG5522 / 36881 FlyBaseID:FBgn0034158 Length:702 Species:Drosophila melanogaster
Sequence 2:XP_232315.7 Gene:Rasgef1a / 312664 RGDID:1305836 Length:489 Species:Rattus norvegicus


Alignment Length:428 Identity:98/428 - (22%)
Similarity:153/428 - (35%) Gaps:73/428 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PTTDYNGYTGQAYAATQFKQSSPPPPPSQ----------QQQQPTRVSKQRSPNTNGSAHTMACL 79
            ||.||  |..:.|..|....|....||..          :|:|......:::...:.|...:..|
  Rat    67 PTVDY--YPDRTYIFTFLLSSRVFMPPHDLLARVGQICLEQRQQLEAGPEKAKLKSFSTKIVQLL 129

  Fly    80 RQ-----------EKTYKEQQMEPPSMQPQASKTLNIKSTRRKNSIGCLNSFSSSPDSPGCYYTI 133
            ::           ||...|.:    ::..:.::......|.:|.....:.|...|..:......:
  Rat   130 KEWTEAFPYDFQDEKAMAELK----AIAHRVTQCDEENGTVKKAITQMIQSLLLSLAARSQLQEL 190

  Fly   134 AASAAPP--SKSQSLPAHASIKQLDAVILSALRVPADVLANQITLLDFPVFAQIQPDELSSCA-- 194
            ......|  .|...|.|.....|.|  ||.....|. |||.|:|.::......|:|::|....  
  Rat   191 REKLRSPVVDKGPVLKAKPPAAQKD--ILGVCSDPL-VLAQQLTHIELERVNSIRPEDLMQIISH 252

  Fly   195 WTKKDKH------VNTPNIVAFTKRFNHTSFWTVQEILNAEQPKQRAEIITHFIKVAKKLHELNN 253
            ....|.|      ..|.::.|:...||..|.....|:....:.|.|..::..||.||::...:.|
  Rat   253 MDSLDNHRCRGDMTKTYSLEAYDNWFNCLSMLVATEVCRVVKKKHRTRMLEFFIDVARECFNIGN 317

  Fly   254 LHSLFAIISAMQSASIYRLTKTWACLSKKDRNAFDRLSDIFSDQDNWANLRSYLE---------- 308
            .:|:.||||.|..:.:.||.|||   ||.....||.|........|:.|.|:.|:          
  Rat   318 FNSMMAIISGMNLSPVARLKKTW---SKVKTAKFDVLEHHMDPSSNFCNYRTALQGATQRSQTAN 379

  Fly   309 -SLRLPCIPYLGLFLTDLIYIDLAHPHKGGLEPEQRRN--KMNNILRVISNYQQSNYKH--LQKH 368
             |.....||...||:.|:.::...|.:.   .|....|  |...|.|.|..:.......  .:|.
  Rat   380 SSREKIVIPVFNLFVKDIYFLHKIHTNH---LPSGHINFKKFWEISRQIHEFMTWTRVECPFEKD 441

  Fly   369 EATQKY-LTSIRYIEEL-----------QNIFEEDQYK 394
            :..|.| ||:..|.||.           :|..|:|.:|
  Rat   442 KKIQSYLLTAPIYSEEALFIASFESEGPENHMEKDSWK 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5522NP_725613.1 RasGEF 163..400 CDD:214539 69/267 (26%)
PH_RalGPS1_2 578..692 CDD:270120
PH 578..685 CDD:278594
Rasgef1aXP_232315.7 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.