DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5522 and Rasgrp1

DIOPT Version :9

Sequence 1:NP_725613.1 Gene:CG5522 / 36881 FlyBaseID:FBgn0034158 Length:702 Species:Drosophila melanogaster
Sequence 2:XP_038960368.1 Gene:Rasgrp1 / 29434 RGDID:3539 Length:818 Species:Rattus norvegicus


Alignment Length:524 Identity:103/524 - (19%)
Similarity:184/524 - (35%) Gaps:173/524 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 SQSLPAHASIKQLDAVILSALRVPADVLANQITLLDFPVFAQIQPDE-----LSSCAWTKKDKHV 202
            :|.:.::.|.|:..:::...|.  .:.|:..:|.|:|..|.:|...:     ::||.       .
  Rat   207 TQRIKSNTSKKRKVSLLFDHLE--PEELSEHLTYLEFKSFRRISFSDYQNYLVNSCV-------K 262

  Fly   203 NTPNIVAFTKRFNHTSFWTVQEILNAEQPKQRAEIITHFIKVAKKLHELNNLHSLFAIISAMQSA 267
            ..|.:.......|..|.|....:|:...|:.|||:...||.||:|||:|.|.::|.|:|..:..:
  Rat   263 ENPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIHVAQKLHQLQNFNTLMAVIGGLCHS 327

  Fly   268 SIYRLTKTWACLSKKDRNAFDRLSDIFSDQDNWANL-RSYLESLRLPCIPYLGLFLTDLIYIDLA 331
            ||.||.:|.:.:..:.......::::.|...|:.|. |:|.|..... ||.||:.|.|||.:..|
  Rat   328 SISRLKETSSHVPHEINKVLGEMTELLSSCRNYDNYRRAYGECTHFK-IPILGVHLKDLISLYEA 391

  Fly   332 HPHKGGLEPEQRRNKMNNILRVISNYQQSNYKHLQKHEATQKYLTSIRYIEE------------- 383
            .|                      :|.:....::||..|...::..:..:::             
  Rat   392 MP----------------------DYLEDGKVNVQKLLALYNHINELVQLQDVAPPLDANKDLVH 434

  Fly   384 -----LQNIFEEDQ-YKRSLNLEPASPSGPSSSSCSSKESFNVEVVTPALGCLNLSPAKTIGSMR 442
                 |...:.||: |:.|...||.:...|.                       |:|:|....:.
  Rat   435 LLTLSLDLYYTEDEIYELSYAREPRNHRAPP-----------------------LTPSKPPVVVD 476

  Fly   443 MASGT------KFVPGHRKCRSLGTKFR------------------SSSLPRNFAEKCQCCIVMI 483
            .|||.      |.:..|.: |.:.:.|:                  ::|.|.:|.       ||.
  Rat   477 WASGVSPKPDPKTISKHVQ-RMVDSVFKNYDLDQDGYISQEEFEKIAASFPFSFC-------VMD 533

  Fly   484 APGIGTISNKR-----CRCRRIFGKIATHNHSDGHPHHLHLELDPSQVQPRHHLLDDSVLEHSDA 543
            ....|.||...     .|...|:.|:..     |.||:..   :.:.::|               
  Rat   534 KDREGLISRDEITAYFMRASSIYSKLGL-----GFPHNFQ---ETTYLKP--------------- 575

  Fly   544 LSQADLTSLESAEGIM---------CDFTGSDC-----DLMSPEAAAAMHGCVRRKTVQKEGRKP 594
                  |..::..|.:         |...|.:|     ||:..|.             :|..:.|
  Rat   576 ------TFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLVVFEC-------------KKRSKSP 621

  Fly   595 AVAS 598
            ||::
  Rat   622 AVST 625

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5522NP_725613.1 RasGEF 163..400 CDD:214539 60/261 (23%)
PH_RalGPS1_2 578..692 CDD:270120 4/21 (19%)
PH 578..685 CDD:278594 4/21 (19%)
Rasgrp1XP_038960368.1 RasGEFN 77..199 CDD:214571
RasGEF 224..460 CDD:214539 62/267 (23%)
EF-hand_7 501..550 CDD:404394 9/55 (16%)
C1_RASGRP1 563..617 CDD:410410 11/90 (12%)
cc_RasGRP1_C 760..814 CDD:412086
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.