DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5522 and Rgl1

DIOPT Version :9

Sequence 1:NP_725613.1 Gene:CG5522 / 36881 FlyBaseID:FBgn0034158 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_001099427.2 Gene:Rgl1 / 289080 RGDID:1308947 Length:803 Species:Rattus norvegicus


Alignment Length:442 Identity:121/442 - (27%)
Similarity:191/442 - (43%) Gaps:88/442 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 CLRQEKTYKEQQMEPPSMQPQASKTLNIKSTRRKNSI----GCLNSFSSSPDSPGCYYTIAASAA 138
            ||::...|.:|.|  |...|: .:..|:....:|..:    |.||:.|.||:             
  Rat   202 CLQKLLEYLKQMM--PGSDPE-RRAQNLLEQFQKQDVDSDNGLLNTISFSPE------------- 250

  Fly   139 PPSKSQSLPAHASIKQLDAVILSALRVPADVLANQITLLDFPVFAQIQPDELSSCAWTKKDKHVN 203
               :.:.|.:..|.:        ......|::|.|:|.:|..:|.::.|.....|.|:::|:..|
  Rat   251 ---EEEELESGGSAE--------LTTFSEDLVAEQLTYMDAQLFKKVVPHHCLGCVWSRRDRKEN 304

  Fly   204 ---TPNIVAFTKRFNHTSFWTVQEILNAEQPK--QRAEIITHFIKVAKKLHELNNLHSLFAIISA 263
               .|.|.|...:||..:...|..||.::..|  |||.:|..:|.:|.:...|.|..||.||:||
  Rat   305 KHLAPTIRATISQFNALTKCVVSTILGSKDLKTQQRARVIEKWINIAHECRILKNFSSLRAIVSA 369

  Fly   264 MQSASIYRLTKTWACLSKKDRNAFDRLSDIFSDQDN---------------WANLRSYLES---- 309
            :||.|||||.|.||.:.|.....|:.||:||||.:|               :|||.|.::.    
  Rat   370 LQSNSIYRLKKAWAAVPKDRMLMFEELSEIFSDHNNHLTSRELLMKEGTSKFANLDSSVKENQKR 434

  Fly   310 ----LRLP--------CIPYLGLFLTDLIYIDLAHPH--KGGLEPEQRRNKMNNILRVISNYQQS 360
                |:|.        .:||||.|||||..:|.|...  :|||...::|.:...::..|...|.:
  Rat   435 TQRRLQLQKDMGVMQGTVPYLGTFLTDLTMLDTALQDYIEGGLINFEKRRREFEVIAQIKLLQSA 499

  Fly   361 NYKHLQKHEATQKYLTSIRYIEELQNIFEEDQYKRSLNLEPASPSGPSSSSCSSKESFNVEVVTP 425
            ...:....:  ||:   |::.:..|.:.||:.|..|..:|.|:.:  |::|...::|....:...
  Rat   500 CNSYCMSPD--QKF---IQWFQRQQLLTEEESYALSCEIEAAADA--STTSPKPRKSMVKRLSLL 557

  Fly   426 ALGCLNLSPAKTIGSMRMASGTKFVPGHRKCRSLGTKFRS---SSLPRNFAE 474
            .||. :|.|..|        .||..|......|.|....|   ||...|.:|
  Rat   558 FLGS-DLIPGST--------PTKEQPKSTASGSSGESMDSVSVSSCESNHSE 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5522NP_725613.1 RasGEF 163..400 CDD:214539 84/274 (31%)
PH_RalGPS1_2 578..692 CDD:270120
PH 578..685 CDD:278594
Rgl1NP_001099427.2 RasGEFN 100..231 CDD:214571 8/31 (26%)
RasGEF 263..532 CDD:238087 84/273 (31%)
RA_RGL 682..768 CDD:340730
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.