DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5522 and RAPGEF1

DIOPT Version :9

Sequence 1:NP_725613.1 Gene:CG5522 / 36881 FlyBaseID:FBgn0034158 Length:702 Species:Drosophila melanogaster
Sequence 2:XP_011516871.1 Gene:RAPGEF1 / 2889 HGNCID:4568 Length:1278 Species:Homo sapiens


Alignment Length:244 Identity:75/244 - (30%)
Similarity:125/244 - (51%) Gaps:36/244 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 LANQITLLDFPVFAQIQPDELSSCAWTKKDKHVNTPNIVAFTKRFNHTSFWTVQEILNAEQPKQR 234
            :|.|:||||..:|.:|:..|:  ..|.|:.....:||:..||:.||:.|:|....|:..|:.:.|
Human  1045 IAEQLTLLDAELFYKIEIPEV--LLWAKEQNEEKSPNLTQFTEHFNNMSYWVRSIIMLQEKAQDR 1107

  Fly   235 AEIITHFIKVAKKLHELNNLHSLFAIISAMQSASIYRLTKTWACLSKKDRNAFDRLSDIFSDQDN 299
            ..::..|||:.|.|.:|||.:|..||:||:.||.|.||  .|      .:...:.|::..:..|:
Human  1108 ERLLLKFIKIMKHLRKLNNFNSYLAILSALDSAPIRRL--EW------QKQTSEGLAEYCTLIDS 1164

  Fly   300 WANLRSY---LESLRLPCIPYLGLFLTDLIYIDLAHP-HKGGLEPEQRRNKMNNILRVISNYQQS 360
            .::.|:|   |..:..||||||||.|.||.::.|.:| :..|.....:|.:..|||..:..:||:
Human  1165 SSSFRAYRAALSEVEPPCIPYLGLILQDLTFVHLGNPDYIDGKVNFSKRWQQFNILDSMRCFQQA 1229

  Fly   361 NYKHLQKHEATQKYLTSIRYIEELQNIF--------EEDQYKRSLNLEP 401
            :|              .:|..:::.|.|        ||..::.||.::|
Human  1230 HY--------------DMRRNDDIINFFNDFSDHLAEEALWELSLKIKP 1264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5522NP_725613.1 RasGEF 163..400 CDD:214539 74/241 (31%)
PH_RalGPS1_2 578..692 CDD:270120
PH 578..685 CDD:278594
RAPGEF1XP_011516871.1 RasGEFN 889..1030 CDD:214571
RasGEF 1037..1266 CDD:214539 75/244 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.