DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5522 and efc25

DIOPT Version :9

Sequence 1:NP_725613.1 Gene:CG5522 / 36881 FlyBaseID:FBgn0034158 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_596123.1 Gene:efc25 / 2540248 PomBaseID:SPBC336.03 Length:987 Species:Schizosaccharomyces pombe


Alignment Length:271 Identity:78/271 - (28%)
Similarity:135/271 - (49%) Gaps:18/271 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 PPSKSQSLPAHASIKQLDAVILSALRVPADVLANQITLLDFPVFAQIQPDELSSCAWTKKDKHVN 203
            |.|.:|.|   .|......:.|:......:..|:|:|||:|....||...|....:|..:|....
pombe   728 PDSLTQRL---LSSPMATFISLNVYAYTPEEFASQMTLLEFDYLKQIPSREWIFRSWVSRDSRSA 789

  Fly   204 TPNIVAFTKRFNHTSFWTVQEILNAEQPKQRAEIITHFIKVAKKLHELNNLHSLFAIISAMQSAS 268
            ..|.:.|:..|   ::|.:..||..:..|.|..:|:.||:.|.|...|.|..:|.:|:||:.||.
pombe   790 VRNYINFSNCF---TYWIINCILEKKNTKARTAVISFFIQTAYKCLSLQNFSTLMSIVSALNSAP 851

  Fly   269 IYRLTKTWACLSKKDRNAFDRLSDIFSDQDNWANLRSYLESLRLPCIPYLGLFLTDLIYIDLAHP 333
            ||||...:..:..:|......|.:|...:.|::..|:.|....|||:|:||:.|:||.:||..:|
pombe   852 IYRLHAAYKLVKAEDIICLSGLREIVETKKNFSTYRALLRKAELPCVPFLGVILSDLTFIDEGNP 916

  Fly   334 HKGGLEPE----QRRNKMNNILRVISNYQQSNYKHLQKHEATQKY-LTSIRYI-EELQNIFEEDQ 392
            ......|.    .:|:::.:::..:..:|.|:|: :|.:...|.| |...|:: ::|..:|:   
pombe   917 DVLDSSPHLLSFNKRHRLADVVADVCRFQSSSYE-MQSNTDLQSYILHRCRFVNQDLSYLFD--- 977

  Fly   393 YKRSLNLEPAS 403
              :||:|||.|
pombe   978 --KSLSLEPRS 986

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5522NP_725613.1 RasGEF 163..400 CDD:214539 68/242 (28%)
PH_RalGPS1_2 578..692 CDD:270120
PH 578..685 CDD:278594
efc25NP_596123.1 RasGEF_N 593..700 CDD:279012
RasGEF 755..932 CDD:279011 55/179 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47356
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23113
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.