DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5522 and ste6

DIOPT Version :9

Sequence 1:NP_725613.1 Gene:CG5522 / 36881 FlyBaseID:FBgn0034158 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_588316.1 Gene:ste6 / 2538724 PomBaseID:SPCC1442.01 Length:911 Species:Schizosaccharomyces pombe


Alignment Length:261 Identity:79/261 - (30%)
Similarity:130/261 - (49%) Gaps:49/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 LRVPADVLANQITLLDFPVFAQIQPDELSSCAW------TKKDKHVNTPNIVAFTKRF---NHTS 218
            |.:|...:|.|:.:|:|..|:.|...:..:..|      :.|:|          |..|   ||..
pombe   660 LLLPPREIAKQLCILEFQSFSHISRIQFLTKIWDNLNRFSPKEK----------TSTFYLSNHLV 714

  Fly   219 FWTVQEILNAEQPKQRAEIITHFIKVAKKLHELNNLHSLFAIISAMQSASIYRLTKTWACLSKKD 283
            .:..:.|:..|:|::|..::.:||:|...|.||||..|||:||||:.|:.|:||.||||.|:.|.
pombe   715 NFVTETIVQEEEPRRRTNVLAYFIQVCDYLRELNNFASLFSIISALNSSPIHRLRKTWANLNSKT 779

  Fly   284 RNAFDRLSDIFSDQDNWANLRSYLESLRLPCIPYLGLFLTDLIYIDLAHPHKGGLEPE------- 341
            ..:|:.|:::...:.|::|.|..||:..|||:|:||::.|||.::      |.|.:..       
pombe   780 LASFELLNNLTEARKNFSNYRDCLENCVLPCVPFLGVYFTDLTFL------KTGNKDNFQNMINF 838

  Fly   342 QRRNKMNNILRVISNYQQSNYKHLQKHEATQKYLTSIRYIEELQN-IFEEDQ-----YKRSLNLE 400
            .:|.|:..||..|..:|...|           ....|..::||.| :...::     |:|||.:|
pombe   839 DKRTKVTRILNEIKKFQSVGY-----------MFNPINEVQELLNEVISRERNTNNIYQRSLTVE 892

  Fly   401 P 401
            |
pombe   893 P 893

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5522NP_725613.1 RasGEF 163..400 CDD:214539 77/258 (30%)
PH_RalGPS1_2 578..692 CDD:270120
PH 578..685 CDD:278594
ste6NP_588316.1 SH3 7..55 CDD:214620
RasGEFN 489..604 CDD:214571
RasGEF 659..895 CDD:214539 79/261 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 109 1.000 Domainoid score I1628
eggNOG 1 0.900 - - E1_KOG3417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003356
OrthoInspector 1 1.000 - - otm47356
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23113
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.