DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5522 and Rasgrp3

DIOPT Version :9

Sequence 1:NP_725613.1 Gene:CG5522 / 36881 FlyBaseID:FBgn0034158 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_001159965.1 Gene:Rasgrp3 / 240168 MGIID:3028579 Length:691 Species:Mus musculus


Alignment Length:269 Identity:77/269 - (28%)
Similarity:121/269 - (44%) Gaps:50/269 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 LANQITLLDFPVFAQIQPDELSSCAWTKKDKHV------NTPNIVAFTKRFNHTSFWTVQEILNA 228
            ||..:|.|:...|.:|        ::|....:|      |.|.:......||..|.|....:|:.
Mouse   156 LAEHLTFLEHKSFRRI--------SFTDYQSYVIHGCLENNPTLERSIALFNGISKWVQLMVLSK 212

  Fly   229 EQPKQRAEIITHFIKVAKKLHELNNLHSLFAIISAMQSASIYRLTKTWACLSKKDRNAFDRLSDI 293
            ...:||||:||.||.||:||.:|.|.::|.|::..:..:||.||..|.:.||.:....::.::::
Mouse   213 PSAQQRAEVITKFINVAQKLLQLKNFNTLMAVVGGLSHSSISRLKDTHSHLSSEVTKNWNEMTEL 277

  Fly   294 FSDQDNWANLRSYLESLRLPCIPYLGLFLTDLIYIDLAHPHKGGLEPEQRRNKMNNILRVISNYQ 358
            .|...|:.|.|..........||.||:.|.|||.:.:..|      .....||:|    |:..:|
Mouse   278 VSSNGNYCNYRKAFADCDGFKIPILGVHLKDLIAVHVIFP------DWMEENKVN----VVKMHQ 332

  Fly   359 QSNYKHLQKHEATQKYLTSIR----YIE---ELQNIF---------EEDQYKRSLNLEPA-SPSG 406
            .|         .|...|.|::    ::|   :|.|:.         |:|.||.||.|||. |.|.
Mouse   333 LS---------VTLSELVSLQNASHHLEPNMDLINLLTLSLDLYHTEDDIYKLSLVLEPRNSKSQ 388

  Fly   407 PSSSSCSSK 415
            |:|.:..:|
Mouse   389 PTSPTTPNK 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5522NP_725613.1 RasGEF 163..400 CDD:214539 69/251 (27%)
PH_RalGPS1_2 578..692 CDD:270120
PH 578..685 CDD:278594
Rasgrp3NP_001159965.1 REM 11..126 CDD:100121
RasGEF 148..384 CDD:214539 72/254 (28%)
EF-hand_7 428..478 CDD:372618
C1 495..544 CDD:237996
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.