DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5522 and Rgl1

DIOPT Version :9

Sequence 1:NP_725613.1 Gene:CG5522 / 36881 FlyBaseID:FBgn0034158 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_001333046.1 Gene:Rgl1 / 19731 MGIID:107484 Length:803 Species:Mus musculus


Alignment Length:374 Identity:104/374 - (27%)
Similarity:168/374 - (44%) Gaps:74/374 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 CLRQEKTYKEQQMEPPSMQPQASKTLNIKSTRRKNSI----GCLNSFSSSPDSPGCYYTIAASAA 138
            ||::...|.:|.|  |...|: .:..|:....:|..:    |.||:.|.|.:             
Mouse   202 CLQKLLEYLKQMM--PGSDPE-RRAQNLLEQFQKQDVDSDNGLLNTSSFSLE------------- 250

  Fly   139 PPSKSQSLPAHASIKQLDAVILSALRVPADVLANQITLLDFPVFAQIQPDELSSCAWTKKDKHVN 203
               :.:.|.:..|.:        ......|::|.|:|.:|..:|.::.|.....|.|:::||..|
Mouse   251 ---EEEELESGGSAE--------FTNFSEDLVAEQLTYMDAQLFKKVVPHHCLGCIWSQRDKKEN 304

  Fly   204 ---TPNIVAFTKRFNHTSFWTVQEILNAEQPK--QRAEIITHFIKVAKKLHELNNLHSLFAIISA 263
               .|.|.|...:||..:...|..:|.:::.|  |||.:|..:|.:|.:...|.|..||.||:||
Mouse   305 KHLAPTIRATISQFNTLTKCVVSTVLGSKELKTQQRARVIEKWINIAHECRILKNFSSLRAIVSA 369

  Fly   264 MQSASIYRLTKTWACLSKKDRNAFDRLSDIFSDQDN---------------WANLRSYLES---- 309
            :||.|||||.|.||.:.|.....|:.|||||||.:|               :|||.|.::.    
Mouse   370 LQSNSIYRLKKAWAAVPKDRMLMFEELSDIFSDHNNHLTSRELLMKEGTSKFANLDSSVKENQKR 434

  Fly   310 ----LRLP--------CIPYLGLFLTDLIYIDLAHPH--KGGLEPEQRRNKMNNILRVISNYQQS 360
                |:|.        .:||||.|||||..:|.|...  :|||...::|.:...::..|...|.:
Mouse   435 TQRRLQLQKDMGVMQGTVPYLGTFLTDLTMLDTALQDYIEGGLINFEKRRREFEVIAQIKLLQSA 499

  Fly   361 NYKHLQKHEATQKYLTSIRYIEELQNIFEEDQYKRSLNLEPASPSGPSS 409
            ...:....:  ||:   |::.:..|.:.||:.|..|..:|.|:.:..:|
Mouse   500 CNSYCMGPD--QKF---IQWFQRQQLLSEEESYALSCEIEAAADANTTS 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5522NP_725613.1 RasGEF 163..400 CDD:214539 85/274 (31%)
PH_RalGPS1_2 578..692 CDD:270120
PH 578..685 CDD:278594
Rgl1NP_001333046.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.