DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5522 and RASGRP4

DIOPT Version :9

Sequence 1:NP_725613.1 Gene:CG5522 / 36881 FlyBaseID:FBgn0034158 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_733749.1 Gene:RASGRP4 / 115727 HGNCID:18958 Length:673 Species:Homo sapiens


Alignment Length:314 Identity:82/314 - (26%)
Similarity:130/314 - (41%) Gaps:51/314 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 SPDSPGCYYTIAASAAPPSKSQSLP-AHASIKQLDAVILSALRVPADVLANQITLLDFPVFAQIQ 186
            ||..||          ||     || :...:.:...|.|....:....||..:|.|:|..|..|.
Human   172 SPGGPG----------PP-----LPMSSPGLGKKRKVSLLFDHLETGELAQHLTYLEFRSFQAIT 221

  Fly   187 PDELSSCAWTKKDKHVNTPNIVAFTKRFNHTSFWTVQEILNAEQPKQRAEIITHFIKVAKKLHEL 251
            |.:|.|  :..:......|.:.......|..|.|....:|:...|.|||:::..||.||::||:|
Human   222 PQDLRS--YVLQGSVRGCPALEGSVGLSNSVSRWVQVMVLSRPGPLQRAQVLDKFIHVAQRLHQL 284

  Fly   252 NNLHSLFAIISAMQSASIYRLTKTWACLSKKDRNAFDRLSDIFSDQDNWANLRSYLESLRLPCIP 316
            .|.::|.|:...:..::|.||..:.|.||.....|...|:::.:..:|:|..|..........:|
Human   285 QNFNTLMAVTGGLCHSAISRLKDSHAHLSPDSTKALLELTELLASHNNYARYRRTWAGCAGFRLP 349

  Fly   317 YLGLFLTDLIYIDLAHPHKGGLEPEQRRN--KMNNILRVISNYQQSNYKHLQKHEATQKYLTSIR 379
            .||:.|.||:.:..|.|.:   .|:.|.:  |:||:           |..||:..|.|.......
Human   350 VLGVHLKDLVSLHEAQPDR---LPDGRLHLPKLNNL-----------YLRLQELVALQGQHPPCS 400

  Fly   380 YIEELQNIF---------EEDQYKRSLNLEPASP-SGPSSSSCSSKESFNVEVV 423
            ..|:|.::.         |::.|:.|...||..| |.|.|       .||..:|
Human   401 ANEDLLHLLTLSLDLFYTEDEIYELSYAREPRCPKSLPPS-------PFNAPLV 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5522NP_725613.1 RasGEF 163..400 CDD:214539 63/247 (26%)
PH_RalGPS1_2 578..692 CDD:270120
PH 578..685 CDD:278594
RASGRP4NP_733749.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
REM 57..164 CDD:100121
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..187 8/29 (28%)
RasGEF 197..432 CDD:214539 64/250 (26%)
C1 541..590 CDD:197519
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 593..621
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 639..673
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.