DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5522 and rapgef3

DIOPT Version :9

Sequence 1:NP_725613.1 Gene:CG5522 / 36881 FlyBaseID:FBgn0034158 Length:702 Species:Drosophila melanogaster
Sequence 2:XP_005162410.1 Gene:rapgef3 / 101886094 ZFINID:ZDB-GENE-090312-38 Length:885 Species:Danio rerio


Alignment Length:329 Identity:77/329 - (23%)
Similarity:132/329 - (40%) Gaps:63/329 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 PSKSQSLPAHASIKQLDAVILSALRVPADVLANQITLLDFPVFAQIQPDELSSCAW-TKKDKHVN 203
            |.|.|..|..:::..|:       ::.:..:|:|.|..|:.:|..:...||....: .:|.....
Zfish   605 PDKEQLGPEKSTMDTLE-------QICSKDMASQHTSYDWELFMAMHEVELVYYVFGREKFPGST 662

  Fly   204 TPNIVAFTKRFNHTSFWTVQEILNAEQPKQRAEIITHFIKVAKKLHELNNLHSLFAIISAMQSAS 268
            |.|:..|.:|||...:|.|.|:...|...:||.::..|||:|..|.|..||:|.||::..:.:::
Zfish   663 TANLERFVRRFNEVQYWVVTELCLCEDLGKRAILLKKFIKMAVVLKEQKNLNSFFAVMFGLSNSA 727

  Fly   269 IYRLTKTWACLSKKDRN---AFDRLSDIFSDQDNWANLRSY---LESLRLPCIPYLGLFLTDLIY 327
            :.||.|||..|..|.:.   |::||      .|...|.|:|   :..|..|.||::.|.|.|:.:
Zfish   728 VQRLNKTWERLPNKTKRIYCAYERL------MDPSRNHRAYRLTIAKLSPPYIPFMPLLLKDMTF 786

  Fly   328 IDLAHPHKGGLEPEQRRNKMNNILRVISNYQQSNYKHLQKHEATQKYLTSIRYIEELQNIFEEDQ 392
            |                                       ||..:.|...:...|:::.|....:
Zfish   787 I---------------------------------------HEGNKNYTDKLVNFEKMRMIARTVK 812

  Fly   393 YKRSLNLEPASPSGPSSSSCSSK--ESFNVEVVTPALGCLNLSPAKTIGSMRMASGTKFVPGHRK 455
            ..|....:|..||.|........  ::..:.:.|.:...|||..|.:|  .:.....|.:...:|
Zfish   813 TVRDCRSQPYVPSSPQKGLTERMFLDAQAIRISTYSDQSLNLRSATSI--RQYIQNLKVIDNQKK 875

  Fly   456 CRSL 459
            ...|
Zfish   876 LTQL 879

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5522NP_725613.1 RasGEF 163..400 CDD:214539 59/243 (24%)
PH_RalGPS1_2 578..692 CDD:270120
PH 578..685 CDD:278594
rapgef3XP_005162410.1 DEP_Epac 71..198 CDD:239884
CAP_ED 222..331 CDD:237999
Crp 241..>321 CDD:223736
RasGEFN 353..485 CDD:214571
RasGEF 620..884 CDD:214539 73/314 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.