DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5522 and rasgrf2

DIOPT Version :9

Sequence 1:NP_725613.1 Gene:CG5522 / 36881 FlyBaseID:FBgn0034158 Length:702 Species:Drosophila melanogaster
Sequence 2:XP_002942408.2 Gene:rasgrf2 / 100486502 XenbaseID:XB-GENE-483993 Length:1232 Species:Xenopus tropicalis


Alignment Length:435 Identity:113/435 - (25%)
Similarity:178/435 - (40%) Gaps:105/435 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ATQFKQSSP---PPPPSQQQQQPTRVSKQRSPNTNG------SAHTMA----------------- 77
            :|...::||   |..|...:.:||.|  |.|.|..|      ||..:|                 
 Frog   835 STDTAENSPCRSPSTPRHLRYRPTGV--QASDNQRGCSVSPASAFAIATAGAGHGSPPGFNNMER 897

  Fly    78 -C-----LRQEKTYK------------------------------EQQMEPPSMQPQASKTLNIK 106
             |     :|:..|.:                              |..:..|.:.||        
 Frog   898 ICDKEFIIRRAATNRVLNVLRHWVSKHAQDFELNHEIKMNVVNLLEDVLRDPDLLPQ-------- 954

  Fly   107 STRRKNSIGCLNSFSSSPDSPGCYYT----IAASAAPPSKSQSLPAHASIKQLDAVILSALRVPA 167
              .||.:...|::.|.. :...|:..    |..|.:|.|:...             .|||:.   
 Frog   955 --ERKAATNILSALSQE-EQDDCHLVLEDIINMSESPSSECLE-------------TLSAME--- 1000

  Fly   168 DVLANQITLLDFPVFAQIQPDELSSCAWTKKDKHVNTPNIVAFTKRFNHTSFWTVQEILNAEQPK 232
              ||.||||||..||..|...|.....|.|.||...||.|:..::.||..|.....||:......
 Frog  1001 --LAEQITLLDHIVFRSIPYQEFLGQGWMKPDKSERTPYIMKTSQHFNDMSNLVASEIMKHPDVP 1063

  Fly   233 QRAEIITHFIKVAKKLHELNNLHSLFAIISAMQSASIYRLTKTWACLSKKDRNAFDRLSDIFSDQ 297
            .||..|..::.||.....::|.:.:..|.||:..:::|||.||||.:||:.:...|:|....|.:
 Frog  1064 SRASSIEKWVVVADICRCMHNYNGVLEITSALNRSAVYRLKKTWAKVSKQTKALMDKLQKTVSSE 1128

  Fly   298 DNWANLRSYLESLRLPCIPYLGLFLTDLIYIDLAHPH--KGGLEPEQRRNKMNNILRVISNYQQS 360
            ..:.|||..|::...|.:||||::||||.:|:...|:  :.||....:...:::|:|.|..:||:
 Frog  1129 GRFKNLRETLKNCNPPSVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQT 1193

  Fly   361 NYKHLQKHEATQKYLTSIRYIEELQNIFEEDQYKRSLNLEPASPS 405
            .|:...:.:.||..|...|.::      |::.|:.||.:||..|:
 Frog  1194 PYRIEHQPKVTQFLLNKSRILD------EDNLYELSLRIEPRLPA 1232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5522NP_725613.1 RasGEF 163..400 CDD:214539 76/238 (32%)
PH_RalGPS1_2 578..692 CDD:270120
PH 578..685 CDD:278594
rasgrf2XP_002942408.2 PH_RasGRF1_2 19..154 CDD:270081
RhoGEF 243..424 CDD:214619
PH 488..582 CDD:365918
RasGEF_N 634..>682 CDD:366199
REM <896..967 CDD:383003 10/80 (13%)
RasGEF 993..1229 CDD:214539 80/259 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.