DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5522 and rapgef5a

DIOPT Version :9

Sequence 1:NP_725613.1 Gene:CG5522 / 36881 FlyBaseID:FBgn0034158 Length:702 Species:Drosophila melanogaster
Sequence 2:XP_002665506.2 Gene:rapgef5a / 100331732 ZFINID:ZDB-GENE-030131-7681 Length:615 Species:Danio rerio


Alignment Length:404 Identity:83/404 - (20%)
Similarity:159/404 - (39%) Gaps:51/404 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YSEISRDLSTDNLRYSELSRKPTTDYNGYTGQAYAATQFKQSSPPPPPSQQQQQPTRVSKQRSPN 68
            |.::|...::.:||.|.:..:........:..:|.:.:.|       |:...|:...:..||...
Zfish   255 YQQLSLKENSVSLRASPVESRDVMCRVYVSCDSYLSMRVK-------PAVVAQELLHIVSQRMDR 312

  Fly    69 TNGSAHTMACLRQEKTYKEQQMEPPSMQPQASKTLNIKSTRRKNSIGCLNSFSSSPDSPGCYYTI 133
            .......:|     :||..   |...:||..|                  .:|.|..:||     
Zfish   313 CEDDMMLLA-----QTYSG---EKRVLQPHDS------------------IYSESLVAPG----- 346

  Fly   134 AASAAPPSKSQSLPAHASIKQLDAVILSALRVPADVLANQITLLDFPVFAQIQPDELSSCAWTKK 198
            ...|.....|:.||.......|....:..|.:....:|..:|..|:.:|..|...||....::::
Zfish   347 RLIACRRDLSEILPPLTECPDLGQKPVRLLGINTWDVAVALTNFDWNLFNSIHEQELIFYTFSRQ 411

  Fly   199 DKHVNTPNIVAFTKRFNHTSFWTVQEILNAEQPKQRAEIITHFIKVAKKLHELNNLHSLFAIISA 263
            ....:|..:....:|.|....|.:.|:|......:|.:::..|||:|.......||:|.||||..
Zfish   412 ASSGHTVALEFLLQRCNEVQQWVMSEVLLCPSLSKRVQLLKKFIKIAAHCKAQRNLNSSFAIIMG 476

  Fly   264 MQSASIYRLTKTWACLSKKDRNAFDRLSDIFSDQDNWANLRSYLESLRLPCIPYLGLFLTDLIYI 328
            :.:|::.||.:||..:..|.:..|..|..:.....|....|...:.::.|.||::.|.|.|:.:|
Zfish   477 LNTAAVSRLNQTWEKVPGKFKKLFSELELLTDPSMNHKAYRDAFKKMKPPKIPFMPLLLKDITFI 541

  Fly   329 DLAHPHKG------GLEPEQRRNKMNNILRVISNYQQSNYKHLQKHEATQKYLTSIRYIEELQNI 387
                 |:|      .|...::.:.:.:.:|:|.:.|.....:......:.:..:|:.|:..:.| 
Zfish   542 -----HEGNKTFHDNLVNFEKLHMIADTVRLIRHCQMDQTGNELSAVDSAEVRSSVHYLHIIDN- 600

  Fly   388 FEEDQYKRSLNLEP 401
             ::..::.|..|||
Zfish   601 -QQTLFELSHRLEP 613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5522NP_725613.1 RasGEF 163..400 CDD:214539 53/242 (22%)
PH_RalGPS1_2 578..692 CDD:270120
PH 578..685 CDD:278594
rapgef5aXP_002665506.2 RasGEFN 100..237 CDD:214571
RasGEF 375..615 CDD:214539 56/246 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.