DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5522 and rasgrp1

DIOPT Version :9

Sequence 1:NP_725613.1 Gene:CG5522 / 36881 FlyBaseID:FBgn0034158 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_001093748.2 Gene:rasgrp1 / 100101791 XenbaseID:XB-GENE-489811 Length:811 Species:Xenopus tropicalis


Alignment Length:297 Identity:74/297 - (24%)
Similarity:121/297 - (40%) Gaps:65/297 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 SQSLPAHASIKQLDAVILSALRVPADVLANQITLLDFPVFAQIQPDE-----LSSCAWTKKDKHV 202
            :|.:..:.|.|:..:::...|. |.: ||..:|.|:|..|.:|...:     :|.|.       .
 Frog   200 TQRIKPNCSKKRKVSLLFDHLE-PQE-LAEHLTYLEFKAFRRISFSDYQNYIVSGCV-------K 255

  Fly   203 NTPNIVAFTKRFNHTSFWTVQEILNAEQPKQRAEIITHFIKVAKKLHELNNLHSLFAIISAMQSA 267
            ..|.:.......|..|.|....:|:...|:.|||::|.||.||:|||:|.|.::|.|:|..:..:
 Frog   256 ENPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVLTKFIHVAQKLHQLQNFNTLMAVIGGLCHS 320

  Fly   268 SIYRLTKTWACLSKKDRNAFDRLSDIFSDQDNWANLRSYLESLRLPCIPYLGLFLTDLIYIDLAH 332
            ||.||..|.|.:|.......:.::::.|...|:.|.|..........||.||:.|.|||.:..| 
 Frog   321 SISRLKDTSAHVSHDVNKVLNEMTELLSSCRNYDNYRRVYNECTNFKIPILGVHLKDLIALHEA- 384

  Fly   333 PHKGGLEPEQRRNKMNNILRVISNYQQSNYKHLQKHEATQKYLTSIRYIEELQNI---------- 387
                  .|:...:...|:.::     .|.|.|:.:             :.:||||          
 Frog   385 ------MPDFLEDSKINVPKL-----HSLYNHINE-------------LIQLQNIAPPLEANMDL 425

  Fly   388 ------------FEEDQYKRSLNLEP----ASPSGPS 408
                        .|::.|:.|...||    |.|..||
 Frog   426 VHLLTLSLDLYYTEDEMYELSYAREPRNHRAPPVTPS 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5522NP_725613.1 RasGEF 163..400 CDD:214539 65/263 (25%)
PH_RalGPS1_2 578..692 CDD:270120
PH 578..685 CDD:278594
rasgrp1NP_001093748.2 REM 77..193 CDD:100121
RasGEF 217..453 CDD:214539 67/269 (25%)
EF-hand_7 494..543 CDD:372618
C1_1 558..607 CDD:365894
BRLZ 744..799 CDD:197664
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.