DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5522 and rapgef5b

DIOPT Version :9

Sequence 1:NP_725613.1 Gene:CG5522 / 36881 FlyBaseID:FBgn0034158 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_001092249.1 Gene:rapgef5b / 100073343 ZFINID:ZDB-GENE-061215-2 Length:341 Species:Danio rerio


Alignment Length:418 Identity:82/418 - (19%)
Similarity:135/418 - (32%) Gaps:139/418 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 EPPSMQPQASKTLNIKSTRRKNSIGCLNSFSSSPDSPGCYYTIAASAAPPSKSQSLPAHASIKQL 155
            |.||.:....|.|.:..:|                           ..||   :.|...:..|:.
Zfish     6 ESPSFKDLVCKVLEVHKSR---------------------------TDPP---RLLKNGSQFKKN 40

  Fly   156 DAVILSALRVPADVLA-------NQITLLDFPVFAQ-IQPDELSSCA--WTKKDKHVNTPNIVAF 210
            ..||:|....|..:|.       :|..:.:.|...| ::...||:|.  |   ..||....|:  
Zfish    41 LEVIISQKPPPDSILCSNAGQTRHQACVNNVPCAGQALRNAVLSNCQDNW---KTHVKLAKII-- 100

  Fly   211 TKRFNHTSFWTVQEILNAEQPKQRAEIITHFIKVAKKLH-----ELNNLHSLFAIISAMQSASIY 270
              |..:.....|:.:::..:..|..||.:....|...|.     |.||:..        .|.|:|
Zfish   101 --RRTYIGIELVEWLMDHCEFIQNREIASKIWNVLLDLGILLSVEQNNIFE--------DSRSLY 155

  Fly   271 RLTKTWACLSKKDRNAFDRLSDIFSDQDNWANLRSYLESLRLPCIPYLGLFLTDLIYIDLAHPHK 335
            :.|     ..:.:..:.|     |.:|.||   ||.:.            .|..|:      ||:
Zfish   156 QFT-----FKECEAQSCD-----FRNQVNW---RSAVH------------LLLQLV------PHE 189

  Fly   336 ---GGLEPEQRRNKM------NNILRVISNYQQSNYKHLQKHEATQKYLTSIRYIEELQNIFEED 391
               ||.:...:.:|.      |.:|::               .|.:.:.::::  .||.......
Zfish   190 QLCGGTQRRCKEDKQKTPDACNPVLQM---------------RALEHFTSTVQ--NELLAALARK 237

  Fly   392 QYKRSLNLEPASP----SGPSSSSCSSKESFNVEVVTPALGCLNLSPAKTIGSMRMASGTKFVPG 452
            ...:|: :|.::|    ..|.|||            |||:  |...|..........|..:.|..
Zfish   238 AQTKSM-MEDSNPQHNTDTPGSSS------------TPAV--LKQVPGAGTRDREEISRLEMVQR 287

  Fly   453 HRK--CRSLGTKFRSSSLPRNFAEKCQC 478
            ..|  ||.|.:..|.:..|..|.| |.|
Zfish   288 LAKDGCRLLHSPLRVNERPAEFVE-CIC 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5522NP_725613.1 RasGEF 163..400 CDD:214539 46/260 (18%)
PH_RalGPS1_2 578..692 CDD:270120
PH 578..685 CDD:278594
rapgef5bNP_001092249.1 DEP 74..191 CDD:295306 33/162 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.