powered by:
Protein Alignment resilin and Cpr30B
DIOPT Version :9
Sequence 1: | NP_611157.1 |
Gene: | resilin / 36880 |
FlyBaseID: | FBgn0034157 |
Length: | 620 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_609295.1 |
Gene: | Cpr30B / 34270 |
FlyBaseID: | FBgn0032125 |
Length: | 153 |
Species: | Drosophila melanogaster |
Alignment Length: | 69 |
Identity: | 23/69 - (33%) |
Similarity: | 34/69 - (49%) |
Gaps: | 4/69 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 336 DYDNDEPAKYEFNYQVEDAPSGLSFGHSEMRDGDFTTGQYNVLLPDGRKQIVEYEA-DQQGYRPQ 399
||. |..|||.:.|.|..:|......|.|..|...|.|.::..||.::||:|:| |..|:...
Fly 27 DYG---PVAYEFQWSVNDPHTGDIKSQKESRKDDKVEGVYELIDSDGYRRIVQYKADDHNGFEAI 88
Fly 400 IRYE 403
::.|
Fly 89 VQRE 92
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR12236 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.