DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment resilin and Cpr5C

DIOPT Version :10

Sequence 1:NP_611157.1 Gene:resilin / 36880 FlyBaseID:FBgn0034157 Length:620 Species:Drosophila melanogaster
Sequence 2:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster


Alignment Length:103 Identity:33/103 - (32%)
Similarity:49/103 - (47%) Gaps:6/103 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 PGGR-----PSDSYGPPASGSGAGGAGGSGPGGADYDNDEPAKYEFNYQVEDAPSGLSFGHSEMR 366
            |.|:     |..:|..||..:............||.:.|...:|::.|.|:||.||.|....|.|
  Fly    21 PAGQLYHAAPVATYAAPAPAAVLKTVAQPVLAKADEEYDPHPQYKYAYDVQDAISGDSKSQVEER 85

  Fly   367 DGDFTTGQYNVLLPDGRKQIVEYEADQ-QGYRPQIRYE 403
            |||...|:|:::..||.|:.|:|.||. .|:...:..|
  Fly    86 DGDVVRGEYSLVDSDGFKRTVQYTADPINGFNAVVNRE 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
resilinNP_611157.1 Chitin_bind_4 345..396 CDD:459790 22/51 (43%)
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:459790 22/51 (43%)

Return to query results.
Submit another query.