DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp53D and ACTL6A

DIOPT Version :9

Sequence 1:NP_477037.2 Gene:Arp53D / 36879 FlyBaseID:FBgn0011743 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_004292.1 Gene:ACTL6A / 86 HGNCID:24124 Length:429 Species:Homo sapiens


Alignment Length:430 Identity:146/430 - (33%)
Similarity:225/430 - (52%) Gaps:57/430 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 MSSEVDSNSHHAAVVIDNGSGVCKAGFSPEDTPRAVFPSIVGR--PRHLNVLLDSVIGDS----- 93
            ||..|.......|:|.|.||...:||::.||.|:..||:.:|.  .|.....|..:.||.     
Human     1 MSGGVYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDKGKQGG 65

  Fly    94 ---VIGEAAAR-KRGILTLKYPIEHGMVKNWDEMEMVWQHTYEL-LRADPMDLPALLTEAPLNPK 153
               .|...|.| .|..:....|:::|||::||..:.:..|||:: ::::....|.|::|||.|.:
Human    66 PTYYIDTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWNTR 130

  Fly   154 KNREKMTEIMFEHFQVPAFYVAVQAVLSLYATGRTVGIVVDSGDGVTHT--VPIYEGFALPHACV 216
            ..|||:||:||||:.:|||::...|||:.:|.||:.|:::||  |.|||  :|:::|:.|....|
Human   131 AKREKLTELMFEHYNIPAFFLCKTAVLTAFANGRSTGLILDS--GATHTTAIPVHDGYVLQQGIV 193

  Fly   217 RVDLAGRDLTDYLCKLLLERGVTMGTS---AEREIVRE-------IKEKLCYVSMNYAKEM---- 267
            :..|||..:|....:|..|..:.:...   |.:|.|||       .||||..|:.::...|    
Human   194 KSPLAGDFITMQCRELFQEMNIELVPPYMIASKEAVREGSPANWKRKEKLPQVTRSWHNYMCNCV 258

  Fly   268 --DLHGKV------------------ETYELPDGQKIVLGCERFRCPEALFQPS----LLGQEVM 308
              |....|                  ..||.|:|.....|.||.:.||.||.||    |.|..::
Human   259 IQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTML 323

  Fly   309 GIHEATHHSITNCDMDLRKDMYANIVLSGGTTMFRNIEHRFLQDLTEMAPPSIRIKV---NASPD 370
            |:......|:..||:|:|..:|.:::::||.|:.::...|..::|::..|||:|:|:   |.:.:
Human   324 GVSHVVTTSVGMCDIDIRPGLYGSVIVAGGNTLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVE 388

  Fly   371 RRFSVWTGGSVLASLTSFQNMWIDSLEYEEVGSAIVHRKC 410
            ||||.|.|||:||||.:||.|||...||||.|...|.|||
Human   389 RRFSSWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKC 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp53DNP_477037.2 ACTIN 46..411 CDD:214592 143/420 (34%)
NBD_sugar-kinase_HSP70_actin 47..411 CDD:302596 143/419 (34%)
ACTL6ANP_004292.1 Actin 11..429 CDD:394979 143/420 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.