DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp53D and ARP4

DIOPT Version :9

Sequence 1:NP_477037.2 Gene:Arp53D / 36879 FlyBaseID:FBgn0011743 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_012454.1 Gene:ARP4 / 853364 SGDID:S000003617 Length:489 Species:Saccharomyces cerevisiae


Alignment Length:489 Identity:120/489 - (24%)
Similarity:191/489 - (39%) Gaps:133/489 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NMSSEVDSNSHHAAVVIDNGSGVCKAGFSPEDTPRAVFPSIVGR----PRHLNVLLDSVIGDSVI 95
            |.:.:|......:|||||.||.....|:|..|.|:::.||:.|:    ..:..:..:..||    
Yeast     3 NAALQVYGGDEVSAVVIDPGSYTTNIGYSGSDFPQSILPSVYGKYTADEGNKKIFSEQSIG---- 63

  Fly    96 GEAAARKRGILTLKYPIEHGMVKNWDEMEMVWQHTY--ELLRADPMDLPALLTEAPLNPKKNREK 158
               ..||.  ..||..||:|:|.:||..:..||...  ||.......:||||||...|..:||:|
Yeast    64 ---IPRKD--YELKPIIENGLVIDWDTAQEQWQWALQNELYLNSNSGIPALLTEPVWNSTENRKK 123

  Fly   159 MTEIMFEHFQVPAFYVAVQAVLSLYATGRTVGIVVDSGDGVTHTVPIYEGFALPHACVRVDLAGR 223
            ..|::.|..|..|.|:|..:....:|.||...:|||.|.......||.:|..|..:..|..:||:
Yeast   124 SLEVLLEGMQFEACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGK 188

  Fly   224 DLTDYLCKLLLERGVTMGTSA--------------------------EREIVREIKEKLCYV--- 259
             ..::|.|..||....:...|                          .|...:|.||.||::   
Yeast   189 -FINHLIKKALEPKEIIPLFAIKQRKPEFIKKTFDYEVDKSLYDYANNRGFFQECKETLCHICPT 252

  Fly   260 -SMNYAK-EMDLHGKVETYELPDGQKIVLGCE-RFRCPEALF----------------------- 298
             ::...| |:....| .:.|.|..::||...| |:...|.||                       
Yeast   253 KTLEETKTELSSTAK-RSIESPWNEEIVFDNETRYGFAEELFLPKEDDIPANWPRSNSGVVKTWR 316

  Fly   299 ---------------------------------------------------------QPSLLGQE 306
                                                                     :|.....|
Yeast   317 NDYVPLKRTKPSGVNKSDKKVTPTEEKEQEAVSKSTSPAANSADTPNETGKRPLEEEKPPKENNE 381

  Fly   307 VMGIHEATHHSITNCDMDLRKDMYANIVLSGGTTMFRNIEHRFLQDLTEMAPPSIRIKV---NAS 368
            ::|:.:..:.||.:.|:|||..:..|:||:|||:....:..|.:.:|.::. ||::.::   ..:
Yeast   382 LIGLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKIL-PSLKFRILTTGHT 445

  Fly   369 PDRRFSVWTGGSVLASLTSFQNMWIDSLEYEEVG 402
            .:|::..|.|||:|.||.:|..:|:...||||||
Yeast   446 IERQYQSWLGGSILTSLGTFHQLWVGKKEYEEVG 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp53DNP_477037.2 ACTIN 46..411 CDD:214592 118/478 (25%)
NBD_sugar-kinase_HSP70_actin 47..411 CDD:302596 118/477 (25%)
ARP4NP_012454.1 COG5277 9..488 CDD:227602 118/483 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.