DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp53D and AT2G42170

DIOPT Version :9

Sequence 1:NP_477037.2 Gene:Arp53D / 36879 FlyBaseID:FBgn0011743 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001323727.1 Gene:AT2G42170 / 818817 AraportID:AT2G42170 Length:329 Species:Arabidopsis thaliana


Alignment Length:325 Identity:194/325 - (59%)
Similarity:248/325 - (76%) Gaps:8/325 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 DSVIGEAAARKRGILTLKYPIEHGMVKNWDEMEMVWQHT-YELLRADPMDLPALLTEAPLNPKKN 155
            |..:|:.|..:.|||||.||:|||:|.|||:||.:|.|| |..||..|.:.|.||||||||||.:
plant     8 DLFVGDDAEARSGILTLDYPMEHGVVSNWDDMEKIWYHTFYSELRVAPEEHPVLLTEAPLNPKAD 72

  Fly   156 REKMTEIMFEHFQVPAFYVAVQAVLSLYATGRTVGIVVDSGDGVTHTVPIYEGFALPHACVRVDL 220
            |||||:||||.|.||:.|:.:||.|||:|:|||.|.|:||||||::.||||||.|||||.:|:||
plant    73 REKMTQIMFETFAVPSMYIGMQAALSLHASGRTTGTVLDSGDGVSYIVPIYEGSALPHAILRLDL 137

  Fly   221 AGRDLTDYLCKLLLERGVTMGTSAEREIVREIKEKLCYVSMNYAKEMDLHGKV----ETYELPDG 281
            |||.||:||.|:::|||.   ||||||:||:|||:..|::::|.:||:...|.    .|||||||
plant   138 AGRHLTNYLMKIMMERGY---TSAEREVVRDIKEQFGYIALDYEQEMEKATKSSAIDRTYELPDG 199

  Fly   282 QKIVLGCERFRCPEALFQPSLLGQEVMGIHEATHHSITNCDMDLRKDMYANIVLSGGTTMFRNIE 346
            |.|.:|.|||||||.||||||:|.|..||||.|::||..||.|:|||:|.||||||||||||.||
plant   200 QVITIGAERFRCPEVLFQPSLIGMETSGIHEKTYNSIMKCDDDIRKDLYGNIVLSGGTTMFRGIE 264

  Fly   347 HRFLQDLTEMAPPSIRIKVNASPDRRFSVWTGGSVLASLTSFQNMWIDSLEYEEVGSAIVHRKCF 411
            .|..:::..:|..::|||:.|.|:|::|||.|||:||||::::.|||...||||.|.||||.|||
plant   265 ERMTKEINALAAANMRIKIVAPPERKYSVWIGGSILASLSTYEQMWITKAEYEENGPAIVHTKCF 329

  Fly   412  411
            plant   330  329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp53DNP_477037.2 ACTIN 46..411 CDD:214592 192/323 (59%)
NBD_sugar-kinase_HSP70_actin 47..411 CDD:302596 192/323 (59%)
AT2G42170NP_001323727.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54227
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 1 1.000 - - FOG0000057
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.