DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp53D and Actrt3

DIOPT Version :9

Sequence 1:NP_477037.2 Gene:Arp53D / 36879 FlyBaseID:FBgn0011743 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_083966.1 Gene:Actrt3 / 76652 MGIID:1923902 Length:369 Species:Mus musculus


Alignment Length:376 Identity:162/376 - (43%)
Similarity:246/376 - (65%) Gaps:15/376 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 NSHHAAVVIDNGSGVCKAGFSPEDTPRAVFPSIVGRPR-HLNVLLDSVIGDS----VIGEAAARK 102
            :.:...||||||||:.|||.:....|:.|:|:|:||.: |        ..||    .:|:.|..:
Mouse     2 SGYQPPVVIDNGSGMIKAGLAGTREPQFVYPNILGRSKGH--------TADSRQELCVGDQAQER 58

  Fly   103 RGILTLKYPIEHGMVKNWDEMEMVWQHTYEL-LRADPMDLPALLTEAPLNPKKNREKMTEIMFEH 166
            |..|::.||:|.|::.:|.:||::|:|.|:. |..:..|.|.|:||..|||..:|:.::|:.||:
Mouse    59 RSFLSISYPVERGLISSWGDMEIMWKHIYDYNLNLNASDGPVLVTEPALNPLADRQHISEVFFEN 123

  Fly   167 FQVPAFYVAVQAVLSLYATGRTVGIVVDSGDGVTHTVPIYEGFALPHACVRVDLAGRDLTDYLCK 231
            ..|||||::.||||:|:|.|.|.|:|::||.|:|..|||:||:.|.|...::::||.|||.||..
Mouse   124 LGVPAFYMSAQAVLALFAAGFTTGLVLNSGAGITQCVPIFEGYCLSHGVKQLNVAGSDLTSYLMM 188

  Fly   232 LLLERGVTMGTSAEREIVREIKEKLCYVSMNYAKEMDLHGKVE-TYELPDGQKIVLGCERFRCPE 295
            ||...|:.:..:.:|::|.:|||..|||:|||..||.....:| .|.||||:.:.|..:.|.|||
Mouse   189 LLKGDGIMLLRTGDRKVVTDIKENACYVAMNYEDEMTKDSNLEKIYTLPDGKTVKLHKQLFHCPE 253

  Fly   296 ALFQPSLLGQEVMGIHEATHHSITNCDMDLRKDMYANIVLSGGTTMFRNIEHRFLQDLTEMAPPS 360
            |||.|.|:..:..||.:....||..||.|||...::||:||||:|.|..::.|.::|:.::||.:
Mouse   254 ALFSPYLVNVDAPGIDKMCFGSIMKCDTDLRNSFFSNIILSGGSTSFPGLDKRLIKDVAKLAPAN 318

  Fly   361 IRIKVNASPDRRFSVWTGGSVLASLTSFQNMWIDSLEYEEVGSAIVHRKCF 411
            ..::|.|.|:|:.|||.|||:||||::||:|||.:.|:||||..|||::||
Mouse   319 TAVQVIAPPERKISVWMGGSILASLSAFQDMWITAAEFEEVGPNIVHQRCF 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp53DNP_477037.2 ACTIN 46..411 CDD:214592 160/371 (43%)
NBD_sugar-kinase_HSP70_actin 47..411 CDD:302596 160/370 (43%)
Actrt3NP_083966.1 ACTIN 5..369 CDD:214592 160/371 (43%)
NBD_sugar-kinase_HSP70_actin 9..369 CDD:302596 159/367 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 1 1.000 - - FOG0000057
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11937
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.