DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp53D and Actrt1

DIOPT Version :9

Sequence 1:NP_477037.2 Gene:Arp53D / 36879 FlyBaseID:FBgn0011743 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_082790.1 Gene:Actrt1 / 73360 MGIID:1920610 Length:376 Species:Mus musculus


Alignment Length:366 Identity:164/366 - (44%)
Similarity:230/366 - (62%) Gaps:2/366 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 AVVIDNGSGVCKAGFSPEDTPRAVFPSIVGRPRHLNVLLDSVIGDSVIGEAAARKRGILTLKYPI 112
            ||:.|||||:||.|.|.|..||.|..|:||.|:.......|......:||.|......|.|.|||
Mouse    11 AVIFDNGSGLCKVGISGEIEPRHVINSVVGHPKFNIPSARSNRKRYFVGEEAQCMYDGLYLHYPI 75

  Fly   113 EHGMVKNWDEMEMVWQHTYEL-LRADPMDLPALLTEAPLNPKKNREKMTEIMFEHFQVPAFYVAV 176
            |.|:|..||:||.:|:..:|. |...|.:.|..:||..|||::.|||.||||||.|.|||.|:..
Mouse    76 ERGLVTRWDDMEKLWKDLFEWELGVKPNEQPVFMTEPSLNPQETREKTTEIMFEKFNVPALYLCN 140

  Fly   177 QAVLSLYATGRTVGIVVDSGDGVTHTVPIYEGFALPHACVRVDLAGRDLTDYLCKLLLERGVTMG 241
            .||.:|.|:....|:|:|||||||.|||:|||::||||..::.:||||:|::|.:|||.:|.|..
Mouse   141 HAVGALCASACITGLVLDSGDGVTCTVPVYEGYSLPHAITKLYVAGRDITEHLTRLLLAKGYTFP 205

  Fly   242 TSAEREIVREIKEKLCYVSMNYA-KEMDLHGKVETYELPDGQKIVLGCERFRCPEALFQPSLLGQ 305
            ....:.:|.:||||||.||:.|. .|.:....:..|.||||..|.:.....:.||.||.|..||.
Mouse   206 CILNKAVVDDIKEKLCTVSLGYKDTEKNCQQFLRKYTLPDGNTIQMSDHLCQVPEVLFTPDHLGI 270

  Fly   306 EVMGIHEATHHSITNCDMDLRKDMYANIVLSGGTTMFRNIEHRFLQDLTEMAPPSIRIKVNASPD 370
            ..:||.:...:||.|||.|::::::|.||||||||||..::.|.|::|.::|.....||:.||.|
Mouse   271 HDLGISKMVCNSIMNCDTDIQENLFAEIVLSGGTTMFPGLQDRLLKELEDLAFEGTPIKITASSD 335

  Fly   371 RRFSVWTGGSVLASLTSFQNMWIDSLEYEEVGSAIVHRKCF 411
            |.:|.|.||||:.|:|:|:.||:.:.:::|.|:.:|.||||
Mouse   336 RCYSAWIGGSVMTSMTTFKQMWVTAEDFKEYGAFVVQRKCF 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp53DNP_477037.2 ACTIN 46..411 CDD:214592 162/364 (45%)
NBD_sugar-kinase_HSP70_actin 47..411 CDD:302596 162/364 (45%)
Actrt1NP_082790.1 NBD_sugar-kinase_HSP70_actin 8..376 CDD:302596 162/364 (45%)
ACTIN 9..376 CDD:214592 162/364 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000057
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11937
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.100

Return to query results.
Submit another query.